DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7115 and fig

DIOPT Version :9

Sequence 1:NP_001260216.1 Gene:CG7115 / 34069 FlyBaseID:FBgn0027515 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_651724.1 Gene:fig / 43511 FlyBaseID:FBgn0039694 Length:314 Species:Drosophila melanogaster


Alignment Length:136 Identity:34/136 - (25%)
Similarity:54/136 - (39%) Gaps:28/136 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   321 IAGTTALIAIV--QGSKLIVANVGDSRGVMYDWRGIAIPLSFDHKPQQVRERKRIHDAGGFIAFR 383
            :..:||.:|.:  :...|..||:||| |.:....|..:     |     |..::.||      |.
  Fly   143 VGSSTACLATMHRKDCTLYTANLGDS-GFLVVRNGRVL-----H-----RSVEQTHD------FN 190

  Fly   384 GVWRVAGVLATSRALGDYPLKDKNLVIATPDILTFELNDHKPHFLILASDGLWDTFSNEEACTFA 448
            ..:::. |....|....|..|.:..|.....:|..:|       ::||:|||:|... |......
  Fly   191 TPYQLT-VPPEDRKESYYCDKPEMAVSTRHSLLPGDL-------VLLATDGLFDNMP-ESMLLSI 246

  Fly   449 LEHLKE 454
            |..|||
  Fly   247 LNGLKE 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7115NP_001260216.1 PP2Cc 111..482 CDD:238083 34/136 (25%)
figNP_651724.1 PP2Cc 68..306 CDD:294085 34/136 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.