DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7115 and ppm1na

DIOPT Version :9

Sequence 1:NP_001260216.1 Gene:CG7115 / 34069 FlyBaseID:FBgn0027515 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_998046.1 Gene:ppm1na / 405817 ZFINID:ZDB-GENE-040426-2731 Length:424 Species:Danio rerio


Alignment Length:215 Identity:66/215 - (30%)
Similarity:107/215 - (49%) Gaps:26/215 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   322 AGTTALIAIVQGSKLIVANVGDSRGVMYDWRGIAIPLSFDHKPQQVRERKRIHDAGGFIAFRGVW 386
            :|:||...::........|.||||..:.. .|..:..:.||||...||::||.:|||.:..:   
Zfish   164 SGSTAASVMISPRNFYFINCGDSRTFLCR-DGHVVFYTEDHKPCNPREKERIQNAGGSVTLQ--- 224

  Fly   387 RVAGVLATSRALGDYPLKD-------KNLVIATPDILTFELNDHKPHFLILASDGLWDTFSNEEA 444
            |:.|.||.||||||:..|:       :.||...|::...| ...:..||::|.||:||...||:.
Zfish   225 RINGSLAVSRALGDFDFKEVEWRAQTEQLVSPEPEVYELE-RSPEDEFLVVACDGVWDAIGNEDL 288

  Fly   445 CTFALEHLKEPD----FGAKSLAMESYKRGSVDNITVLVIVFKNDVYKIGSSAGKAGEESLKVPA 505
            |.|....|...|    ..::.:.:..|| ||:||:|:::|.|        ..|.|..:|:|:..|
Zfish   289 CAFVRNRLHVCDDLREICSQVIDLCLYK-GSLDNMTIIIICF--------DGAPKVTQEALQQEA 344

  Fly   506 K-SQPVAPAVVQRSNSIKTK 524
            : .|.:...|.:..:.|::|
Zfish   345 ELEQLIEQKVAEIIHVIRSK 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7115NP_001260216.1 PP2Cc 111..482 CDD:238083 56/170 (33%)
ppm1naNP_998046.1 PP2Cc 67..329 CDD:238083 56/170 (33%)
PP2C_C 323..400 CDD:285117 12/50 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.