DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7115 and CG12091

DIOPT Version :9

Sequence 1:NP_001260216.1 Gene:CG7115 / 34069 FlyBaseID:FBgn0027515 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_001261261.1 Gene:CG12091 / 38177 FlyBaseID:FBgn0035228 Length:321 Species:Drosophila melanogaster


Alignment Length:398 Identity:75/398 - (18%)
Similarity:126/398 - (31%) Gaps:177/398 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 VKNIYNKIIEMSKLLKTEGNSGDYDKSPYLARKQSRKDANKENTEP-TAGVMR-----------K 214
            :::.::.::|.:    |.|.||           .:.|.|.|....| ::|..|           |
  Fly    16 LRSSFSTLLETA----TGGGSG-----------AAAKGATKSGATPGSSGAPRPRFVSVVCGFAK 65

  Fly   215 DSLRKAH--STTADCSAIKQKTTEASIADIYTVQLNSAMRASGNLGAAK---------DSFLN-- 266
            |:||..:  ....:.|..|..|..|.:           |..:..:|..:         .|||.  
  Fly    66 DNLRHKYKPGKYGEDSWFKASTASADV-----------MGVADGVGGWRSYGIDPGEFSSFLMRT 119

  Fly   267 -------NNNNGQNGAANAPPPNYEAKCYIEHGRINFGKLITDEIMSADYKLVEQAKRATNIAGT 324
                   ::.|.|.      |.|..|..|.|                    |:||.|..  :..:
  Fly   120 CERLVQCSHFNPQR------PVNLLAYSYCE--------------------LMEQKKPI--LGSS 156

  Fly   325 TALIAIV--QGSKLIVANVGDSRGVMYDWRGIAIPLSFDHKPQQVRERKRIHDAGGFIAFRGVWR 387
            ||.:.|:  :.|.:..||:|||..|:                  |||.:.:|             
  Fly   157 TACVLILNRETSTVHTANIGDSGFVV------------------VREGQVVH------------- 190

  Fly   388 VAGVLATSRALGDY-----------PLKDKNLVIATP---DILTFELNDHKPHFLILASDGLWDT 438
                  .|.....|           |....|::..:|   |.::|.:.|  ...:::|:||::|.
  Fly   191 ------KSEEQQHYFNTPFQLSLPPPGHGPNVLSDSPESADTMSFPVRD--GDVILIATDGVFDN 247

  Fly   439 FSNEEACTFALEHLKEPD---------FGAKSLAME----------------SYKR-------GS 471
            ...:    ..|:.|.|.:         ..|.|||:.                |.:|       |.
  Fly   248 VPED----LMLQVLSEVEGERDPVKLQMTANSLALMARTLSLNSEFLSPFALSARRNNIQARGGK 308

  Fly   472 VDNITVLV 479
            .|:|||::
  Fly   309 PDDITVVL 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7115NP_001260216.1 PP2Cc 111..482 CDD:238083 75/398 (19%)
CG12091NP_001261261.1 PP2Cc 76..316 CDD:294085 60/321 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.