DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7115 and AT2G05050

DIOPT Version :9

Sequence 1:NP_001260216.1 Gene:CG7115 / 34069 FlyBaseID:FBgn0027515 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_001154495.1 Gene:AT2G05050 / 3767735 AraportID:AT2G05050 Length:193 Species:Arabidopsis thaliana


Alignment Length:363 Identity:79/363 - (21%)
Similarity:107/363 - (29%) Gaps:181/363 - (49%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 MEDRFIIEENINNNTGISFFAVFDGHGGEFAADFAKDVLVKNIYNKIIEMSKLLKTEGNSGDYDK 187
            |||||....|::.:...:.|.|:.||||..||:||...|.|||..:::                 
plant     1 MEDRFSTITNLHGDRKQAIFGVYVGHGGVKAAEFAAKNLDKNIVEEVV----------------- 48

  Fly   188 SPYLARKQSRKDANKENTEPTAGVMRKDSLRKAHSTTADCSAIKQKTTEASIADIYTVQLNSAMR 252
                                          .|.|              |..||:           
plant    49 ------------------------------GKRH--------------ELEIAE----------- 58

  Fly   253 ASGNLGAAKDSFLNNNNNGQNGAANAPPPNYEAKCYIEHGRINFGKLITDEIMSADYKLVEQAKR 317
                  |.|..||                                .::..|:|:           
plant    59 ------ALKFYFL--------------------------------IIVRLEMMN----------- 74

  Fly   318 ATNIAGTTALIAIVQGSKLIVANVGDSRGVMYDWRGIAIPLSFDHKPQQVRERKRIHDAGGFIAF 382
                           |.:|                          ||::          ...|.|
plant    75 ---------------GKEL--------------------------KPRE----------DMLIRF 88

  Fly   383 RGVWRVAGVLATSRALGDYPLKDKNLVIATPDILTFELNDHKPHFLILASDGLWDTFSNEEAC-- 445
            . :||:.|.|...|.:||..|  |..|||.|:.....: :|...||||||.||||..||:||.  
plant    89 T-LWRIQGSLVVPRGIGDAQL--KKWVIAEPETKISRV-EHDHEFLILASHGLWDKVSNQEAVDI 149

  Fly   446 --TFALEHLKEPDFGA-KSLAMESYKRGSVDNITVLVI 480
              .|.|...|.....| |.|...|..|||.|:|:|::|
plant   150 ARPFCLRTEKPLLLAACKKLVDLSASRGSFDDISVMLI 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7115NP_001260216.1 PP2Cc 111..482 CDD:238083 79/363 (22%)
AT2G05050NP_001154495.1 PP2Cc 1..189 CDD:238083 79/363 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 45 1.000 Domainoid score I4631
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1044139at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.