DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7115 and CG10376

DIOPT Version :9

Sequence 1:NP_001260216.1 Gene:CG7115 / 34069 FlyBaseID:FBgn0027515 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster


Alignment Length:408 Identity:100/408 - (24%)
Similarity:154/408 - (37%) Gaps:153/408 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 SAGDHQSWEEMKQQSSAFAVLGRRPR-MEDRFI-------IEENINNNTGISFFAVFDGHGGEFA 153
            :|.::....:.|:.....|.:..:|| ||||.:       :.|.::..|  .||.|||||.|..:
  Fly   145 AAPENCECHQQKEPLHTSAAVKNKPRKMEDRCVCLDRFGEMYELLDKTT--RFFGVFDGHSGSLS 207

  Fly   154 ADFAKDVLVKNIYNKIIEMSKLLKTEGNSGDYDKSPYLARKQSRKDANKENTEPTAGVMRKDSLR 218
            |.:|..           ::.:||                     .|..|.|.:|.          
  Fly   208 ATYATS-----------QLPQLL---------------------ADQLKANPDPA---------- 230

  Fly   219 KAHSTTADCSAIKQKTTEASIADIYTVQLNSAMRASGNLGAAKDSFLNNNNNGQNGAANAPPPNY 283
                              |...|.|.....||.                                
  Fly   231 ------------------AFSPDFYRNAFESAF-------------------------------- 245

  Fly   284 EAKCYIEHGRINFGKLITDEIMSADYKLVEQAKRATNIAGTTALIAIVQGSKLIVANVGDSRGVM 348
                           |:.||..:        .|:.|  :|||::.|::...:|.:|.||||:.::
  Fly   246 ---------------LLADERFT--------QKKIT--SGTTSVCALITKDQLYIAWVGDSKALL 285

  Fly   349 YDWRGIAIPLSFDHKPQQVRERKRIHDAGGFIAF-RGVWRVAGVLATSRALGDYPLKDKNLVIAT 412
            ...| ..:.|...|||:...|||||..|||.:.. :|.|||.|:|..:|::|||.|:   .|||.
  Fly   286 VGKR-TQLQLVKPHKPENPDERKRIETAGGTVLHAQGQWRVNGILNVARSIGDYSLE---AVIAE 346

  Fly   413 PDILTFELND-HKPHFLILASDGLWD----------TFSNEEACTFALEHLKEPDFGAKSLAMES 466
            ||.:..:||: |  .||:|.:|||||          .:.:....|..|:.:.:       |.:|:
  Fly   347 PDFVDVQLNEAH--DFLVLGTDGLWDHVPESLIIETVYDSLADTTMKLDDIPK-------LLIEA 402

  Fly   467 YK-RGSVDNITVLVIVFK 483
            .| |.|.||||.:|::.|
  Fly   403 AKERDSQDNITAVVVLLK 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7115NP_001260216.1 PP2Cc 111..482 CDD:238083 97/391 (25%)
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 97/390 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445089
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1044139at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13832
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X119
65.850

Return to query results.
Submit another query.