DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7115 and Pp2d1

DIOPT Version :9

Sequence 1:NP_001260216.1 Gene:CG7115 / 34069 FlyBaseID:FBgn0027515 Length:524 Species:Drosophila melanogaster
Sequence 2:XP_038939402.1 Gene:Pp2d1 / 316157 RGDID:1564811 Length:651 Species:Rattus norvegicus


Alignment Length:361 Identity:74/361 - (20%)
Similarity:131/361 - (36%) Gaps:109/361 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 RFIIEENINNNTGISFFAVFDGHGGEFAADFA-------------------------KDVLVKNI 165
            :|.:..:..:...:.||.:||.|.|..|||.|                         :|::  |.
  Rat   218 KFTVVNDFGDKANVCFFGLFDSHHGYAAADLASKEFQVLLLHQLSVQDPSYQMTAEQQDLI--NS 280

  Fly   166 YNKIIEMSKLLKTEGNSGDYDKSPYLARKQSRKDANKENTEPTAGVMRKDSLRK------AHSTT 224
            ::.:.......:.|..|..|  ..:...|:..:|.:|...:   ...|.|.|.:      :....
  Rat   281 FHTVFREEYRAREEAFSSTY--KTFRTNKREYEDVHKAFAK---AFWRMDRLLRLGRNEVSRVRW 340

  Fly   225 ADCSAIKQKTTEASIADIYTVQLNSAMRASGNLGAAKDSFLNNNNNGQNGAANAPPPNYEAKCYI 289
            :.|||:             |..|...::   |..|.||                    :| |.| 
  Rat   341 SGCSAL-------------TCILEGGIK---NPQATKD--------------------WE-KTY- 367

  Fly   290 EHGRINFGKLITDEIMSADYKLVEQAKRATNIAGTTALIAIVQGSKLIVANVGDSRGVMYDWRGI 354
            :||           :.|:.::.:.|               |:.| .|.:||.|:.:.|:.. .|.
  Rat   368 QHG-----------VNSSPFQKIPQ---------------IISG-VLHIANAGNVQAVLCR-NGK 404

  Fly   355 AIPLSFDHKPQQVRERKRI-HDAGGFIAFRGVWRVAGVLATSRALGDY-PLKDKNLVIATPDILT 417
            ...|:.:|..:..:||:|: :...|..:......:.|.:.|:|.||.: .|:.|..:|..|..::
  Rat   405 GFCLTKEHTTRNTKERRRVLYSEVGISSDDPYGLLDGHIKTTRGLGFHGNLRLKKAIIPVPQTIS 469

  Fly   418 FELNDHKPHFLILASDGLWDTFSNEE--ACTFALEH 451
            ..::| ...|||||::|||.....:|  |....|.|
  Rat   470 VPIDD-LCQFLILATNGLWQVLDKKEVTALVITLFH 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7115NP_001260216.1 PP2Cc 111..482 CDD:238083 74/361 (20%)
Pp2d1XP_038939402.1 PP2Cc 214..499 CDD:238083 72/354 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.