DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7115 and Pptc7

DIOPT Version :9

Sequence 1:NP_001260216.1 Gene:CG7115 / 34069 FlyBaseID:FBgn0027515 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_001100611.1 Gene:Pptc7 / 304488 RGDID:1310383 Length:307 Species:Rattus norvegicus


Alignment Length:207 Identity:41/207 - (19%)
Similarity:69/207 - (33%) Gaps:88/207 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   321 IAGTTALIAIVQGS--KLIVANVGDSRGVMYDWRGIAIPLSFDHKPQQVRERKRIHDAGGFIAFR 383
            :..:||.|.::..|  :|..||:|||                                 ||:..|
  Rat   137 LGSSTACIVVLDRSSHRLHTANLGDS---------------------------------GFLVVR 168

  Fly   384 GVWRVAGVLATSRALGDYPLKDKNLVIATPDILTFELNDHKP------------HFLILASDGLW 436
            |    ..|:..|.....|......|.||.|:.....|:|...            ..::.|:|||:
  Rat   169 G----GEVVHRSDEQQHYFNTPFQLSIAPPEAEGVVLSDSPDAADSTSFDVQLGDIILTATDGLF 229

  Fly   437 DTFSN----EEACTFALEHLKEPDF-----GAKSLAMESY-----------------------KR 469
            |...:    :|     |:.||..::     .|:|:|.:::                       :.
  Rat   230 DNMPDYMILQE-----LKKLKNSNYESIQRTARSIAEQAHELAYDPNYMSPFAQFACDNGLNVRG 289

  Fly   470 GSVDNITVLVIV 481
            |..|:||||:.:
  Rat   290 GKPDDITVLLSI 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7115NP_001260216.1 PP2Cc 111..482 CDD:238083 41/207 (20%)
Pptc7NP_001100611.1 PP2Cc 63..299 CDD:412173 40/203 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.