Sequence 1: | NP_001260216.1 | Gene: | CG7115 / 34069 | FlyBaseID: | FBgn0027515 | Length: | 524 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001100611.1 | Gene: | Pptc7 / 304488 | RGDID: | 1310383 | Length: | 307 | Species: | Rattus norvegicus |
Alignment Length: | 207 | Identity: | 41/207 - (19%) |
---|---|---|---|
Similarity: | 69/207 - (33%) | Gaps: | 88/207 - (42%) |
- Green bases have known domain annotations that are detailed below.
Fly 321 IAGTTALIAIVQGS--KLIVANVGDSRGVMYDWRGIAIPLSFDHKPQQVRERKRIHDAGGFIAFR 383
Fly 384 GVWRVAGVLATSRALGDYPLKDKNLVIATPDILTFELNDHKP------------HFLILASDGLW 436
Fly 437 DTFSN----EEACTFALEHLKEPDF-----GAKSLAMESY-----------------------KR 469
Fly 470 GSVDNITVLVIV 481 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG7115 | NP_001260216.1 | PP2Cc | 111..482 | CDD:238083 | 41/207 (20%) |
Pptc7 | NP_001100611.1 | PP2Cc | 63..299 | CDD:412173 | 40/203 (20%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0631 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |