DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7115 and Ppm1j

DIOPT Version :9

Sequence 1:NP_001260216.1 Gene:CG7115 / 34069 FlyBaseID:FBgn0027515 Length:524 Species:Drosophila melanogaster
Sequence 2:XP_008759602.1 Gene:Ppm1j / 295341 RGDID:1359104 Length:522 Species:Rattus norvegicus


Alignment Length:432 Identity:92/432 - (21%)
Similarity:156/432 - (36%) Gaps:165/432 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 NNNTGISFF--AVFDGHGGEFAADFAKDVLVKNIYNKIIEMSKLLKTEGNSGDYDKSPYLARKQS 196
            ::|.|.||:  .:||||.|..||:.|..:|.::|..::.::.::|:        |..|       
  Rat   161 SHNQGFSFYYWGLFDGHAGGGAAEMASRLLHRHIREQLKDLVEILQ--------DPLP------- 210

  Fly   197 RKDANKENTEPTAGVMRKDSLRKAHSTTADCSAIKQKTTEASIADIYTVQLNSAMRASGNLGAAK 261
             ......:|..|.||.....|....|.:.     :::.|..|:.                :||.:
  Rat   211 -PPLCLPSTPGTPGVSSPSQLVSPQSWSP-----QKEVTHDSLV----------------VGAIE 253

  Fly   262 DSFLNNNNNGQNGAANAPPPNYEAKCYIEHGRINFGKLITDEIMSADYK--LVEQAKRATNIAGT 324
            ::|                                  .:.||.|:.:.:  |||        .|.
  Rat   254 NAF----------------------------------QLMDEQMARERRGHLVE--------GGC 276

  Fly   325 TALIAIVQGSKLIVANVGDSRGVMYDWRGIAIPLSFDHKPQQVRER------------------- 370
            .||:.:....|:.|||.||||.::.. .|..||:|.:..|:..|:|                   
  Rat   277 CALVVVYLLGKMYVANAGDSRAIIVR-NGEIIPMSREFTPETERQRLQLLGFLKPELLGSEFTHL 340

  Fly   371 ---KRIH--DAGGFIAFR-----------------------GVWRVAGVLAT---SRALGDYPLK 404
               :|:.  :.|..:.:|                       |..:.|.|:||   :|.|||:.||
  Rat   341 EFPRRVQPKELGQRMLYRDQNMTGWAYKKIELEDLRFPLVCGEGKKARVMATIGVTRGLGDHNLK 405

  Fly   405 -------DKNLVIATPDILTFELN--DHKP-HFLILASDGLWDTFSNEEACTFALEHLK--EPD- 456
                   .|..:...|::..::|.  :|.| ..|:|.:|||||..::.|........|.  ||: 
  Rat   406 VCSSTLPIKPFLSCFPEVRVYDLTQYEHCPDDVLVLGTDGLWDVTNDSEVAATVDRVLSTYEPND 470

  Fly   457 ------------FGAKSL------AMESYKRGSVDNITVLVI 480
                        .||:.:      .:.:.|.||.|:|:|.||
  Rat   471 PSRYTALAQALVLGARGIPRDRGWRLPNNKLGSGDDISVFVI 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7115NP_001260216.1 PP2Cc 111..482 CDD:238083 92/432 (21%)
Ppm1jXP_008759602.1 PP2Cc 123..514 CDD:238083 92/432 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.