DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7115 and SPAC10F6.17c

DIOPT Version :9

Sequence 1:NP_001260216.1 Gene:CG7115 / 34069 FlyBaseID:FBgn0027515 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_593268.2 Gene:SPAC10F6.17c / 2543002 PomBaseID:SPAC10F6.17c Length:444 Species:Schizosaccharomyces pombe


Alignment Length:194 Identity:58/194 - (29%)
Similarity:80/194 - (41%) Gaps:50/194 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   298 KLITDEIMSADYKLV-EQAKRATN---------------IAGTTALIA--IVQGSKLIVANVGDS 344
            |.|::.....|:::| |......|               ::|:.||:.  ..:...|.||..|||
pombe   165 KSISEAFAKVDHQIVHEHVSHVFNNPESLQVAASLLLPALSGSCALLTSYSAKSKSLQVACTGDS 229

  Fly   345 RGVMYD------WRGIAIPLSFDHKPQQVRERKRIH-DAGGFIAFRGVWRVAGVLATSRALGD-- 400
            |.|:.:      |.  |||||.|.......|..|:. :..|....|.. |:.|.|..|||.||  
pombe   230 RAVLGECTPDGSWE--AIPLSRDQTGMNPDEASRLEVEHPGEEVLRNN-RILGRLMPSRAFGDAR 291

  Fly   401 --------------------YPLKDKNLVIATPDILTFELNDHKPHFLILASDGLWDTFSNEEA 444
                                .|:|....|.|.|:|.:..:|..|..|||:||||||||.|:|:|
pombe   292 YKWSQEISERLHREYFSASPIPVKTPPYVTAVPEIESITVNPKKHRFLIMASDGLWDTMSSEQA 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7115NP_001260216.1 PP2Cc 111..482 CDD:238083 58/194 (30%)
SPAC10F6.17cNP_593268.2 PP2Cc 78..437 CDD:214625 58/194 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.