DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7115 and Ppm1b

DIOPT Version :9

Sequence 1:NP_001260216.1 Gene:CG7115 / 34069 FlyBaseID:FBgn0027515 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_001257548.1 Gene:Ppm1b / 24667 RGDID:3374 Length:465 Species:Rattus norvegicus


Alignment Length:417 Identity:97/417 - (23%)
Similarity:148/417 - (35%) Gaps:155/417 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 QSWEEMKQQSSAFAVLGRRPRMEDRFIIEENINNNTGISFFAVFDGHGGEFAADFAKDVLVKNIY 166
            |.| .::.:.:..||:|....:||             .|||||:|||.|...|::....|::   
  Rat    30 QGW-RVEMEDAHTAVVGIPHGLED-------------WSFFAVYDGHAGSRVANYCSTHLLE--- 77

  Fly   167 NKIIEMSKLLKTEGNSGDYDKSPYLARKQSRKDANKENTEPTAGVMRKDSLRKAHSTTADCSAIK 231
                                                                  |.||       
  Rat    78 ------------------------------------------------------HITT------- 81

  Fly   232 QKTTEASIADIYTVQLNSAMRASGNLGAAKDSFLNNNNNGQNGAANAPPPNYEAKCYIEHGRINF 296
                            |...||:...|.|.:..:.|...|                      |..
  Rat    82 ----------------NEDFRAADKSGFALEPSVENVKTG----------------------IRT 108

  Fly   297 GKLITDEIMSADYKLVEQAKRATNIAGTTALIAIVQGSKLIVANVGDSRGVMYDWRGIAIPLSFD 361
            |.|..||.|    :.....:...:.:|:||:..::..:.:...|.||||.|:.. .|.....:.|
  Rat   109 GFLKIDEYM----RNFSDLRNGMDRSGSTAVGVMISPTHIYFINCGDSRAVLCR-NGQVCFSTQD 168

  Fly   362 HKPQQVRERKRIHDAGGFIAFRGVWRVAGVLATSRALGDYPLK-------DKNLVIATPDILTFE 419
            |||....|::||.:|||.:.   :.||.|.||.|||||||..|       .:.||...|::... 
  Rat   169 HKPCNPMEKERIQNAGGSVM---IQRVNGSLAVSRALGDYDYKCVDGKGPTEQLVSPEPEVYEI- 229

  Fly   420 LNDHKPHFLILASDGLWDTFSNEEACTFALEHLKEPDFGAKSLAMES---------YKRGSVDNI 475
            |...:..|::||.||:||..||||.|.|....|:..|      .:|:         ..:||.||:
  Rat   230 LRAEEDEFVVLACDGIWDVMSNEELCEFVNSRLEVSD------DLENVCNWVVDTCLHKGSRDNM 288

  Fly   476 TVLVIVFKNDVYKIGSSAGKAGEESLK 502
            :::::.|.|        |.|..:|::|
  Rat   289 SIVLVCFAN--------APKVSDEAVK 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7115NP_001260216.1 PP2Cc 111..482 CDD:238083 89/386 (23%)
Ppm1bNP_001257548.1 PP2Cc 23..295 CDD:238083 91/395 (23%)
PP2C_C 289..365 CDD:285117 6/27 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.