DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7115 and Ppm1a

DIOPT Version :9

Sequence 1:NP_001260216.1 Gene:CG7115 / 34069 FlyBaseID:FBgn0027515 Length:524 Species:Drosophila melanogaster
Sequence 2:XP_038967714.1 Gene:Ppm1a / 24666 RGDID:3373 Length:455 Species:Rattus norvegicus


Alignment Length:355 Identity:98/355 - (27%)
Similarity:159/355 - (44%) Gaps:62/355 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   193 RKQSRKDA-----NKENTEP-------TAGVMRKDSLRKAHSTTADCSAIK-----QKTTEASIA 240
            |||:|...     .|||.:|       ....:.|..:.| |:.....:.::     .:.....:.
  Rat    47 RKQTRGGHTKWLWEKENPKPDLEDQVIMGAFLDKPKMEK-HNAQGQGNGLRYGLSSMQGWRVEME 110

  Fly   241 DIYT--VQLNSAMRA-------SGNLGA--AK---DSFLNNNNNGQNGAANAPPPNYEAKCYIEH 291
            |.:|  :.|.|.:..       .|:.|:  ||   :..|::..|.|:...:|..|:.|   .:::
  Rat   111 DAHTAVIGLPSGLETWSFFAVYDGHAGSQVAKYCCEHLLDHITNNQDFKGSAGAPSVE---NVKN 172

  Fly   292 GRINFGKLITDEIMSADYKLVEQAKRATNIAGTTALIAIVQGSKLIVANVGDSRGVMYDWRGIAI 356
            | |..|.|..||.|    :::.:.|...:.:|:||:..::........|.|||||::...|.:..
  Rat   173 G-IRTGFLEIDEHM----RVMSEKKHGADRSGSTAVGVLISPQHTYFINCGDSRGLLCRNRKVHF 232

  Fly   357 PLSFDHKPQQVRERKRIHDAGGFIAFRGVWRVAGVLATSRALGDYPLK-------DKNLVIATPD 414
             .:.||||....|::||.:|||.:.   :.||.|.||.||||||:..|       .:.||...|:
  Rat   233 -FTQDHKPSNPLEKERIQNAGGSVM---IQRVNGSLAVSRALGDFDYKCVHGKGPTEQLVSPEPE 293

  Fly   415 ILTFELNDHKPHFLILASDGLWDTFSNEEACTFALEHLKEPDFGAK---SLAMESYKRGSVDNIT 476
            :...|.::....|:|||.||:||...|||.|.|....|:..|...|   .:......:||.||::
  Rat   294 VHDIERSEEDDQFIILACDGIWDVMGNEELCDFVRSRLEVTDDLEKVCNEVVDTCLYKGSRDNMS 358

  Fly   477 VLVIVFKNDVYKIGSSAGKAGEESLKVPAK 506
            |::|.|.|        |.|...|::|..|:
  Rat   359 VILICFPN--------APKVSAEAVKKEAE 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7115NP_001260216.1 PP2Cc 111..482 CDD:238083 91/329 (28%)
Ppm1aXP_038967714.1 PP2Cc 96..364 CDD:238083 80/279 (29%)
PP2C_C 358..436 CDD:400262 9/31 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.