DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7115 and Ppm1a

DIOPT Version :9

Sequence 1:NP_001260216.1 Gene:CG7115 / 34069 FlyBaseID:FBgn0027515 Length:524 Species:Drosophila melanogaster
Sequence 2:XP_036013148.1 Gene:Ppm1a / 19042 MGIID:99878 Length:454 Species:Mus musculus


Alignment Length:378 Identity:103/378 - (27%)
Similarity:170/378 - (44%) Gaps:57/378 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 KDVLVKNIYNKIIEMSKLLKTEGNSGDYDKSPYLARKQSRKDANKENTEPTAGVMRKDSLRKAHS 222
            |:..:|.:..|....|:..:|.|    |.|  :|..||..| .:.|:.......:.|..:.| |:
Mouse    30 KEKEIKGVQKKGRRESRRKQTRG----YMK--WLWEKQKPK-PDLEDQVIMGAFLDKPKMEK-HN 86

  Fly   223 TTADCSAIK-----QKTTEASIADIYT--VQLNSAMRA-------SGNLGA--AK---DSFLNNN 268
            .....:.::     .:.....:.|.:|  :.|.|.:..       .|:.|:  ||   :..|::.
Mouse    87 AQGQGNGLRYGLSSMQGWRVEMEDAHTAVIGLPSGLETWSFFAVYDGHAGSQVAKYCCEHLLDHI 151

  Fly   269 NNGQNGAANAPPPNYEAKCYIEHGRINFGKLITDEIMSADYKLVEQAKRATNIAGTTALIAIVQG 333
            .|.|:...:|..|:.|   .:::| |..|.|..||.|    :::.:.|...:.:|:||:..::..
Mouse   152 TNNQDFRGSAGAPSVE---NVKNG-IRTGFLEIDEHM----RVMSEKKHGADRSGSTAVGVLISP 208

  Fly   334 SKLIVANVGDSRGVMYDWRGIAIPLSFDHKPQQVRERKRIHDAGGFIAFRGVWRVAGVLATSRAL 398
            ......|.|||||::...|.:.. .:.||||....|::||.:|||.:.   :.||.|.||.||||
Mouse   209 QHTYFINCGDSRGLLCRNRKVHF-FTQDHKPSNPLEKERIQNAGGSVM---IQRVNGSLAVSRAL 269

  Fly   399 GDYPLK-------DKNLVIATPDILTFELNDHKPHFLILASDGLWDTFSNEEACTFALEHLKEPD 456
            ||:..|       .:.||...|::...|.::....|:|||.||:||...|||.|.|....|:..|
Mouse   270 GDFDYKCVHGKGPTEQLVSPEPEVHDIERSEEDDQFIILACDGIWDVMGNEELCDFVRSRLEVTD 334

  Fly   457 FGAK---SLAMESYKRGSVDNITVLVIVFKNDVYKIGSSAGKAGEESLKVPAK 506
            ...|   .:......:||.||::|::|.|        .||.|...|::|..|:
Mouse   335 DLEKVCNEVVDTCLYKGSRDNMSVILICF--------PSAPKVSAEAVKKEAE 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7115NP_001260216.1 PP2Cc 111..482 CDD:238083 96/352 (27%)
Ppm1aXP_036013148.1 PP2Cc 95..363 CDD:238083 80/279 (29%)
PP2C_C 357..435 CDD:400262 9/31 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.