DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7115 and W09D10.4

DIOPT Version :9

Sequence 1:NP_001260216.1 Gene:CG7115 / 34069 FlyBaseID:FBgn0027515 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_499362.1 Gene:W09D10.4 / 176497 WormBaseID:WBGene00012362 Length:330 Species:Caenorhabditis elegans


Alignment Length:215 Identity:46/215 - (21%)
Similarity:77/215 - (35%) Gaps:82/215 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   308 DYKLVEQAKRATNIAGTTALIAIVQGSKLIVANVGDSRGVMYDWRGIAIPLSFDHKPQQVRERKR 372
            ||.....|:....:..:||.:.:|...||..||:||| |.|....|..:.          :.|::
 Worm   155 DYAFRASAEAPRPVGSSTACVLVVHQEKLYSANLGDS-GFMVVRNGKIVS----------KSREQ 208

  Fly   373 IH----------DAGGFIAFRGVWRVAGVLATSRALGD-YPLKDKNLVIATPDILTFELNDHKPH 426
            :|          ...|:..|               :|| ..:.||:           |:...|..
 Worm   209 VHYFNAPFQLTLPPEGYQGF---------------IGDKADMADKD-----------EMAVKKGD 247

  Fly   427 FLILASDGLWDTFSNEEACTFALEHLKEPDFG--------------AKSLAMESYKR-------- 469
            .::||:||:||..|.::    .|:.||..|.|              |:.||.:|...        
 Worm   248 IILLATDGVWDNLSEQQ----VLDQLKALDAGKSNVQEVCNALALTARRLAFDSKHNSPFAMKAR 308

  Fly   470 --------GSVDNITVLVIV 481
                    |..|:||:::::
 Worm   309 EHGFLAPGGKPDDITLVLLL 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7115NP_001260216.1 PP2Cc 111..482 CDD:238083 46/215 (21%)
W09D10.4NP_499362.1 PP2Cc 72..327 CDD:214625 46/212 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.