DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7115 and pdp-1

DIOPT Version :9

Sequence 1:NP_001260216.1 Gene:CG7115 / 34069 FlyBaseID:FBgn0027515 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_491357.1 Gene:pdp-1 / 172035 WormBaseID:WBGene00022832 Length:451 Species:Caenorhabditis elegans


Alignment Length:346 Identity:80/346 - (23%)
Similarity:122/346 - (35%) Gaps:104/346 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 FAVFDGHGGEFAADFAKDVLVKNIYNKIIEMSKLLKTEGNSGDYDKSPYLARKQSRKDANKENTE 206
            |.|||||||:..:......|...:...:::..:::       ||.....|....|..|.:..|  
 Worm    70 FGVFDGHGGQQCSRHISTNLYPYLCASVLKKHEVV-------DYPSDQRLEWLFSSSDGHLPN-- 125

  Fly   207 PTAGVMRKDSLRKAHSTTADCSAIKQKTTEASIADIYTVQLNSAMRASGNLGAAKDSF-LNNNNN 270
                                  |.|.:.|: .||: |..|...  .|:...|..:::. |.....
 Worm   126 ----------------------AFKGRETQ-HIAE-YHKQFKK--NANAYTGTVREALKLAFETC 164

  Fly   271 GQNGAANAPPPNYEAKCYIEHGRINFGKLITDEIMSADYKLVEQAKRATNIA--GTTALIAIVQG 333
            .::.|.||.|   .||..|:                         :.|..:|  |:...:|.::.
 Worm   165 DKDLAENALP---SAKGVID-------------------------RHAAMVAASGSCCTLAHIRS 201

  Fly   334 SKLIVANVGDSRGVMYDWRGIAIP--------LSFDHKPQQVRERKRI---HDAG-GFIAFRGVW 386
            ..|.|||:||:..|:    |:..|        ||..|......|..||   |.|. .....|| .
 Worm   202 RHLHVANLGDAAAVL----GVVNPNGSVTARQLSRAHCVDNADEVHRIRIAHPASESQTVLRG-G 261

  Fly   387 RVAGVLATSRALGD----YPLKDKNLVIA-----------TPDILTF--ELNDHK----PHFLIL 430
            |:.|.|...||.||    :||..:.:|:.           ||..|:.  |:..||    ..||:|
 Worm   262 RLLGELFPLRAFGDVRYKWPLDLQKVVLEPLGHPPPQHLFTPPYLSTSPEVFYHKLTPNDRFLVL 326

  Fly   431 ASDGLWDTFSNEEACTFALEH 451
            |:||||:....:.......:|
 Worm   327 ATDGLWEWLDPDTVVRLVHDH 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7115NP_001260216.1 PP2Cc 111..482 CDD:238083 80/346 (23%)
pdp-1NP_491357.1 PP2Cc 43..438 CDD:238083 80/346 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.