Sequence 1: | NP_001260216.1 | Gene: | CG7115 / 34069 | FlyBaseID: | FBgn0027515 | Length: | 524 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_644812.1 | Gene: | PPTC7 / 160760 | HGNCID: | 30695 | Length: | 304 | Species: | Homo sapiens |
Alignment Length: | 207 | Identity: | 40/207 - (19%) |
---|---|---|---|
Similarity: | 68/207 - (32%) | Gaps: | 88/207 - (42%) |
- Green bases have known domain annotations that are detailed below.
Fly 321 IAGTTALIAIVQ--GSKLIVANVGDSRGVMYDWRGIAIPLSFDHKPQQVRERKRIHDAGGFIAFR 383
Fly 384 GVWRVAGVLATSRALGDYPLKDKNLVIATPDILTFELNDHKP------------HFLILASDGLW 436
Fly 437 DTFSN----EEACTFALEHLKEPDF-----GAKSLAMESY-----------------------KR 469
Fly 470 GSVDNITVLVIV 481 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG7115 | NP_001260216.1 | PP2Cc | 111..482 | CDD:238083 | 40/207 (19%) |
PPTC7 | NP_644812.1 | PP2Cc | 60..296 | CDD:412173 | 39/203 (19%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0631 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |