DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7115 and AgaP_AGAP002141

DIOPT Version :9

Sequence 1:NP_001260216.1 Gene:CG7115 / 34069 FlyBaseID:FBgn0027515 Length:524 Species:Drosophila melanogaster
Sequence 2:XP_308054.4 Gene:AgaP_AGAP002141 / 1269417 VectorBaseID:AGAP002141 Length:298 Species:Anopheles gambiae


Alignment Length:344 Identity:68/344 - (19%)
Similarity:100/344 - (29%) Gaps:139/344 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 HQSWEEMKQQSSAFAVLGRRPRMEDRFI-----IEEN-----------------INNNTGISFFA 143
            ||:|:      :|.|....:||...|||     ..:|                 |.|........
Mosquito    14 HQNWQ------AASATAENKPRTYSRFISVVSGFPKNLAQSKYKPGKMGDDAWFIANTKTADVLG 72

  Fly   144 VFDGHG---------GEFAADFAKDVLVKNIYNKIIEMSKLLKTEGNSGDYDKSPYLARKQSRKD 199
            |.||.|         ||||.     ||::|....:                        |.||.|
Mosquito    73 VADGVGGWRSYGIDPGEFAM-----VLMRNCERLV------------------------KFSRFD 108

  Fly   200 ANKENTEPTAGVMRKDSLRKA--HSTTADCSAIKQKTTEASIADIYTVQLNSAMRASGNLGAAKD 262
            ..|......:|.......||.  .|:|| |..:..:..    :.|||..:..    ||.:...|.
Mosquito   109 PIKPVNLIASGFRELQDNRKCILGSSTA-CIVVFNRED----SSIYTANIGD----SGFIIVRKG 164

  Fly   263 SFLNNNNNGQN-----GAANAPPPNYEAKCYIEHGRINFGKLITDEIMSADYKLVEQAKRATNIA 322
            ..::.:...|:     ...:.|||.:.             .:::|...||:              
Mosquito   165 EIVHRSEEQQHYFNTPFQLSLPPPGHT-------------DVLSDRPESAN-------------- 202

  Fly   323 GTTALIAIVQGSKLIVANVG---------------------DSRGVMYDWRGIAI---PLSFDHK 363
              |....:..|..::||..|                     |...:......||:   .||||.|
Mosquito   203 --TTTFPVCNGDVILVATDGVFDNVPIKLLVDTLQRVEGENDQVKLQMCANSIALMARSLSFDSK 265

  Fly   364 ---PQQVRERK-RIHDAGG 378
               |..|..|: .|:..||
Mosquito   266 FLSPFSVNARRNNINAMGG 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7115NP_001260216.1 PP2Cc 111..482 CDD:238083 65/334 (19%)
AgaP_AGAP002141XP_308054.4 PP2Cc 58..293 CDD:294085 57/294 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.