DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7115 and AgaP_AGAP002149

DIOPT Version :9

Sequence 1:NP_001260216.1 Gene:CG7115 / 34069 FlyBaseID:FBgn0027515 Length:524 Species:Drosophila melanogaster
Sequence 2:XP_003436039.1 Gene:AgaP_AGAP002149 / 1269409 VectorBaseID:AGAP002149 Length:1485 Species:Anopheles gambiae


Alignment Length:251 Identity:54/251 - (21%)
Similarity:77/251 - (30%) Gaps:100/251 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 ASAGDHQSWEEMKQQSSAFAVLGRRPRMEDRFIIEENINNNTGISFFAVFDGHGGEFAADFAKDV 160
            ||:...||.|....|||                ||:.:...:|.|  :.|.|...|.||      
Mosquito   931 ASSDISQSPEFKMLQSS----------------IEQQLGKTSGSS--SPFAGGESELAA------ 971

  Fly   161 LVKNIYNKIIEMSKLLKTEGNSGDYDKSPYLARKQSRKDANKENTEPTAGVMRKDSLRKAHSTTA 225
                 |:|  |.|.|     .:..||..|.|...|          ||.|.|   ||         
Mosquito   972 -----YHK--EASAL-----EASVYDPEPGLLSSQ----------EPAASV---DS--------- 1002

  Fly   226 DCSAIKQKTTEASIADIYTVQLNSAMRASGN----LGAAKDSFLNNNNNGQNGAANAPPPNYEAK 286
                                   |..:||.|    :|.|.|...:            |.|..||.
Mosquito  1003 -----------------------SEQQASQNYMDLMGGAPDQKAD------------PEPMVEAA 1032

  Fly   287 CYIEHGRINF---GKLITDEIMSADYKLVEQAKRATNIAGTTALIAIVQGSKLIVA 339
            ...|...:..   ..:.:|:..:.:.::||..|.:.::|||....|....:..:.|
Mosquito  1033 KPQESAELPAEPEQPIASDDKKAEEPQVVEAEKESADVAGTAVAAAAAAATVAVAA 1088

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7115NP_001260216.1 PP2Cc 111..482 CDD:238083 48/236 (20%)
AgaP_AGAP002149XP_003436039.1 rne <1023..1167 CDD:236766 14/78 (18%)
PRK14950 <1378..>1475 CDD:237864
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X119
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.