DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7115 and fgfbp1

DIOPT Version :9

Sequence 1:NP_001260216.1 Gene:CG7115 / 34069 FlyBaseID:FBgn0027515 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_001106374.1 Gene:fgfbp1 / 100124301 XenbaseID:XB-GENE-945938 Length:224 Species:Xenopus tropicalis


Alignment Length:108 Identity:22/108 - (20%)
Similarity:39/108 - (36%) Gaps:32/108 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 MSKLLKTEGNS---GDYDKSPYLARKQSRKDA--------------------NKENTEPTAGVMR 213
            ||.:|..|||:   |..::......|::..|:                    :|||...|..|..
 Frog    16 MSNVLLVEGNNQREGKKERGKAKGEKKAEADSPQGKGGRTRGGKGSLQGKFVSKENATCTWAVTE 80

  Fly   214 KDSLRKAHSTTADCSAIKQKTTEASIADIYTVQLNSAMRASGN 256
            ..|:    :...||     :..|:|.:..:....:|..:.:||
 Frog    81 AQSV----TLRIDC-----RKEESSFSCSFGGNPSSCPKYAGN 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7115NP_001260216.1 PP2Cc 111..482 CDD:238083 22/108 (20%)
fgfbp1NP_001106374.1 FGF-BP1 14..221 CDD:368931 22/108 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165166845
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.