DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LanB1 and LanB2

DIOPT Version :10

Sequence 1:NP_476618.1 Gene:LanB1 / 34068 FlyBaseID:FBgn0261800 Length:1788 Species:Drosophila melanogaster
Sequence 2:XP_308240.3 Gene:LanB2 / 1269597 VectorBaseID:AGAMI1_007290 Length:1624 Species:Anopheles gambiae


Alignment Length:189 Identity:38/189 - (20%)
Similarity:59/189 - (31%) Gaps:68/189 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VGCYENRQQLQALTICAL-LAVSTLLPMVESAKFKSRSKPSSSSSSSSGRVSKPSSSSSSSSSYS 70
            :||.::.|    |.:|:| :.|.|:|         .|..|...|...|.||.:   ....:.:::
Mosquito    96 IGCSDDLQ----LFLCSLYVPVCTIL---------ERPIPPCRSLCESARVCE---KLMKTYNFN 144

  Fly    71 NPGSLSYSNYQSKPAPKPSAPVDTSNQRNIGWNVNSQAKPATGAAAVNKPPYPVQASAPVQSSAA 135
            .|.:|..|.:          ||.......:..|..|.|                       |:||
Mosquito   145 WPENLECSKF----------PVHGGEDLCVAENTTSSA-----------------------STAA 176

  Fly   136 KPPPYPVQATHNTHQTHAGAPPPPYSQGPPPPYSAANNPNMHSGFNVPPPAYTPGNQGF 194
            .|.....:.|...|||                  ...:|:.:.||..|....||...|:
Mosquito   177 TPTRSVAKVTTRKHQT------------------GVESPHRNIGFVCPVQLKTPLGMGY 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LanB1NP_476618.1 Laminin_N 54..286 CDD:459653 25/141 (18%)
EGF_Lam 287..343 CDD:238012
Laminin_EGF 355..415 CDD:395007
Laminin_EGF 418..475 CDD:395007
EGF_Lam 477..526 CDD:238012
EGF_Lam 529..567 CDD:214543
EGF_Lam 789..834 CDD:214543
Laminin_EGF 837..885 CDD:395007
Laminin_EGF 883..930 CDD:395007
Laminin_EGF 933..988 CDD:395007
Laminin_EGF 991..1035 CDD:395007
Laminin_EGF 1043..1091 CDD:395007
Laminin_EGF 1094..1142 CDD:395007
Laminin_EGF 1142..1190 CDD:395007
Mplasa_alph_rch 1228..>1771 CDD:275316
cc_DmLAMB1-like_C 1717..1786 CDD:411973
LanB2XP_308240.3 Laminin_N 50..280 CDD:459653 38/189 (20%)
EGF_Lam 281..328 CDD:238012
Laminin_EGF 342..397 CDD:395007
EGF_Lam 397..441 CDD:214543
Laminin_EGF 444..494 CDD:395007
Laminin_B 560..692 CDD:459652
EGF_Lam 727..769 CDD:238012
Laminin_EGF 831..881 CDD:395007
Laminin_EGF 886..937 CDD:395007
EGF_Lam 940..985 CDD:214543
Laminin_EGF 988..1030 CDD:395007
SMC_prok_B <1046..>1606 CDD:274008
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.