DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cdc14 and AT5G56610

DIOPT Version :9

Sequence 1:NP_001285721.1 Gene:cdc14 / 34067 FlyBaseID:FBgn0031952 Length:1052 Species:Drosophila melanogaster
Sequence 2:NP_200472.2 Gene:AT5G56610 / 835762 AraportID:AT5G56610 Length:228 Species:Arabidopsis thaliana


Alignment Length:140 Identity:36/140 - (25%)
Similarity:62/140 - (44%) Gaps:28/140 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   229 VIRLN--------AKVYHASSFENAGFDHKDLFF----IDGSTPSDAIMKKFLSICETTKGAIAV 281
            ||.||        :.:|.|...|:.....:|..|    :|.:...:.|.|..| :.:||    .|
plant    96 VITLNEPYETLVPSSLYSAYEMEHLVIPTRDYLFAPSIVDITLAVNFIHKNAL-LGKTT----YV 155

  Fly   282 HCKAGLGRTGSLIGAYIMKHYGFTALEAIAWLRLCRPGSVIGHQQQWMEDKQSWLWSEGERMRRR 346
            |||||.||:.:::..|:::|...|...|...:|..||..::...|:.:.::.|.|.|        
plant   156 HCKAGRGRSTTVVLCYLIEHKSMTVAAAFEHVRSIRPRVLLHPSQRKVVEEFSRLQS-------- 212

  Fly   347 TSLPILQHTY 356
               |:.:.|:
plant   213 ---PLSESTF 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cdc14NP_001285721.1 DSPn 19..156 CDD:291343
PTPc 217..331 CDD:304379 31/113 (27%)
CDC14 <229..330 CDD:225297 31/112 (28%)
AT5G56610NP_200472.2 PTPMT1 66..209 CDD:350374 31/117 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1386941at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.