DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cdc14 and AT2G35680

DIOPT Version :9

Sequence 1:NP_001285721.1 Gene:cdc14 / 34067 FlyBaseID:FBgn0031952 Length:1052 Species:Drosophila melanogaster
Sequence 2:NP_565816.1 Gene:AT2G35680 / 818137 AraportID:AT2G35680 Length:337 Species:Arabidopsis thaliana


Alignment Length:300 Identity:65/300 - (21%)
Similarity:117/300 - (39%) Gaps:103/300 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 EYEYFERVENGDFNWIVPQKFIAFCGPHQKSKTLPNGYPCHAPERYFSYFRDNNVTTVIRLN--- 233
            |:.:::||........||                   :|...|:     .::..|..||.||   
plant    70 EFRWWDRVAEFILLGAVP-------------------FPSDVPQ-----LKELGVCGVITLNEPY 110

  Fly   234 AKVYHASSFENAGFDH-----KDLFFIDGSTPS-DAIMK--KFL----SICETTKGAIAVHCKAG 286
            ..:..:|.:::...||     :|..|    .|| :||.:  :|:    |:.:||    .||||||
plant   111 ETLVPSSLYKSYCIDHLVIATRDYCF----APSMEAICQAVEFIHRNASLGKTT----YVHCKAG 167

  Fly   287 LGRTGSLIGAYIMKHYGFTALEAIAWLRLCRPGSVIGHQQQW----------MEDKQSWLWSEGE 341
            .||:.:::..|:::|...|...|.:::|..|| .|:....||          :.:.||.|.....
plant   168 RGRSTTIVICYLVQHKNMTPEAAYSYVRSIRP-RVLLAAAQWKAVVEYYHVKVLNTQSCLTDATS 231

  Fly   342 RMRRRT---------------SLPILQHT--YGINSLELKKK---------LASAAADSTEHVDL 380
            .:..|.               |:.::.|:  .|.|..:.:.:         |.:||||.:     
plant   232 ALIPRNVKQVCSGNVVVFDDGSMVVVTHSDLEGYNDDDSRSRRSVKVNGNELWAAAADLS----- 291

  Fly   381 LLTRVKGISQ----RVDTMHLNDQDNLDAACTDQTDEELS 416
            ::.|||.:.|    |:..:.|..::          |::||
plant   292 MVYRVKVVGQAAMARISCLWLGLRE----------DQKLS 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cdc14NP_001285721.1 DSPn 19..156 CDD:291343
PTPc 217..331 CDD:304379 36/138 (26%)
CDC14 <229..330 CDD:225297 35/125 (28%)
AT2G35680NP_565816.1 PTPMT1 73..215 CDD:350374 42/174 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1386941at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.