DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cdc14 and cdc14b

DIOPT Version :9

Sequence 1:NP_001285721.1 Gene:cdc14 / 34067 FlyBaseID:FBgn0031952 Length:1052 Species:Drosophila melanogaster
Sequence 2:NP_001096152.1 Gene:cdc14b / 733733 XenbaseID:XB-GENE-977314 Length:362 Species:Xenopus tropicalis


Alignment Length:362 Identity:187/362 - (51%)
Similarity:239/362 - (66%) Gaps:26/362 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 MKLNTKLNAKCHANKKIVHYTSMNPAKRLNAAYLIGSYAIIYLNKTPQEAYRPLVAGEIPAYTRF 133
            ||||.|:.:.....|||||||..:..|:.|||:|:||:|||||||.|.|.||.|...: ..|..|
 Frog     1 MKLNKKIKSFSLTKKKIVHYTCGDDKKQANAAFLVGSFAIIYLNKQPLELYRLLQTAK-TNYLPF 64

  Fly   134 CDASYGPSNFKISLLDCLNAVHKGLQAGFFNFNDFDAEEYEYFERVENGDFNWIVPQKFIAFCGP 198
            .|||:|...|.::||||..||||.||..||:|..||.|||:::||.||||||||:|:||:||.||
 Frog    65 RDASFGTCTFHLTLLDCFFAVHKALQYNFFDFKTFDVEEYQHYERAENGDFNWIIPEKFLAFSGP 129

  Fly   199 HQKSKTLPNGYPCHAPERYFSYFRDNNVTTVIRLNAKVYHASSFENAGFDHKDLFFIDGSTPSDA 263
            ||||| :.:|||.||||.||.|||.:|:||:||||.|:|.|..|.:|.|:|.||||:||||||||
 Frog   130 HQKSK-IESGYPHHAPEAYFPYFRKHNITTIIRLNKKMYEAKRFTDANFEHYDLFFVDGSTPSDA 193

  Fly   264 IMKKFLSICETTKGAIAVHCKAGLGRTGSLIGAYIMKHYGFTALEAIAWLRLCRPGSVIGHQQQW 328
            |::|||:|||..:|||||||||||||||:|||:|:||||..||.|.|||:|:||||||||.|||:
 Frog   194 IVRKFLNICENAEGAIAVHCKAGLGRTGTLIGSYMMKHYRMTAAETIAWIRICRPGSVIGPQQQF 258

  Fly   329 MEDKQSWLWSEGERMRRRTSLPILQHTYGINSLELKKKLASAAADSTEHVDLLLTRVKGISQRVD 393
            |.:||..||:||:..|                    |||......:...|..:|:.|..||...|
 Frog   259 MVEKQRSLWNEGDIYR--------------------KKLQEQENGNRCAVTFILSGVDDISISDD 303

  Fly   394 TMHLNDQDNLDAACTDQTDEEL----SEQLRLERDER 426
            ......::::.....|..||.:    .::||..:.:|
 Frog   304 KGKACGKEDIGLYSEDDDDESIHVTQGDKLRALKCKR 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cdc14NP_001285721.1 DSPn 19..156 CDD:291343 44/86 (51%)
PTPc 217..331 CDD:304379 80/113 (71%)
CDC14 <229..330 CDD:225297 71/100 (71%)
cdc14bNP_001096152.1 DSPn <1..88 CDD:317115 45/87 (52%)
CDC14 111..282 CDD:225297 117/191 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 159 1.000 Domainoid score I4033
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 484 1.000 Inparanoid score I1415
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001645
OrthoInspector 1 1.000 - - otm47524
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1202
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.