powered by:
Protein Alignment cdc14 and ptpmt1
DIOPT Version :9
Sequence 1: | NP_001285721.1 |
Gene: | cdc14 / 34067 |
FlyBaseID: | FBgn0031952 |
Length: | 1052 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001073656.1 |
Gene: | ptpmt1 / 567019 |
ZFINID: | ZDB-GENE-070112-272 |
Length: | 183 |
Species: | Danio rerio |
Alignment Length: | 55 |
Identity: | 17/55 - (30%) |
Similarity: | 30/55 - (54%) |
Gaps: | 0/55 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 278 AIAVHCKAGLGRTGSLIGAYIMKHYGFTALEAIAWLRLCRPGSVIGHQQQWMEDK 332
::.:|||||..|:.::..||:::.:.::..||...|...||..:|...|..|..|
Zfish 118 SVYIHCKAGRSRSATIAAAYLIRLHCWSPEEACKMLASVRPHVLIRSSQLEMLQK 172
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
cdc14 | NP_001285721.1 |
DSPn |
19..156 |
CDD:291343 |
|
PTPc |
217..331 |
CDD:304379 |
16/52 (31%) |
CDC14 |
<229..330 |
CDD:225297 |
15/51 (29%) |
ptpmt1 | NP_001073656.1 |
PTPc |
<86..176 |
CDD:304379 |
17/55 (31%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1386941at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.