DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cdc14 and DUSP23

DIOPT Version :9

Sequence 1:NP_001285721.1 Gene:cdc14 / 34067 FlyBaseID:FBgn0031952 Length:1052 Species:Drosophila melanogaster
Sequence 2:NP_001306587.1 Gene:DUSP23 / 54935 HGNCID:21480 Length:150 Species:Homo sapiens


Alignment Length:161 Identity:42/161 - (26%)
Similarity:66/161 - (40%) Gaps:36/161 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 VENGDFNWIVPQKFIAFCGPHQKSKTLPNGYPCHAPERYFSYFRDNNVTTVIRLNAKVYHASSFE 243
            |:..:|:|::|.:......|.     ||..|.                   ..|:..|.|..|..
Human     3 VQPPNFSWVLPGRLAGLALPR-----LPAHYQ-------------------FLLDLGVRHLVSLT 43

  Fly   244 NAGFDHKD---------LFFIDGSTPSDAIMKKFLSICETTKG---AIAVHCKAGLGRTGSLIGA 296
            ..|..|.|         |...|...|:...:.:|:.|.:....   |:.|||..|.||||:::..
Human    44 ERGPPHSDSCPGLTLHRLRIPDFCPPAPDQIDRFVQIVDEANARGEAVGVHCALGFGRTGTMLAC 108

  Fly   297 YIMKHYGFTALEAIAWLRLCRPGSVIGHQQQ 327
            |::|..|..|.:|||.:|..||||:..::|:
Human   109 YLVKERGLAAGDAIAEIRRLRPGSIETYEQE 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cdc14NP_001285721.1 DSPn 19..156 CDD:291343
PTPc 217..331 CDD:304379 34/123 (28%)
CDC14 <229..330 CDD:225297 34/111 (31%)
DUSP23NP_001306587.1 DUSP23 8..148 CDD:350354 41/156 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1720
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.