DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cdc14 and dusp23b

DIOPT Version :9

Sequence 1:NP_001285721.1 Gene:cdc14 / 34067 FlyBaseID:FBgn0031952 Length:1052 Species:Drosophila melanogaster
Sequence 2:NP_001002462.1 Gene:dusp23b / 436735 ZFINID:ZDB-GENE-040718-163 Length:152 Species:Danio rerio


Alignment Length:158 Identity:38/158 - (24%)
Similarity:66/158 - (41%) Gaps:34/158 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 DFNWIVPQKFIAFCGPHQKSKTLPNGYPCHAPERYFSYFRDNNVTTVIRLNAKVYHASSFENAGF 247
            :|:|:.|.|......|...:              ::.|..::.:..::.|.         |....
Zfish     8 NFSWVDPGKVAGLAMPRMTA--------------HYQYLLNSGIKHLVTLT---------ERKPP 49

  Fly   248 DH---KDLF-----FIDGSTPSDAIMKKFLSICETTKG---AIAVHCKAGLGRTGSLIGAYIMKH 301
            ||   .||.     ..|...|:...:.:||:|.|....   |:||||..|.||||:::..|::|.
Zfish    50 DHDTCPDLTLHHIKINDFCAPTFEQINRFLTIVEEANASGQAVAVHCLHGFGRTGTMLACYLVKS 114

  Fly   302 YGFTALEAIAWLRLCRPGSVIGHQQQWM 329
            ...:.::||..:|..|.||:...:|:.|
Zfish   115 RKISGIDAINEIRRIRRGSIETREQEQM 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cdc14NP_001285721.1 DSPn 19..156 CDD:291343
PTPc 217..331 CDD:304379 33/124 (27%)
CDC14 <229..330 CDD:225297 32/112 (29%)
dusp23bNP_001002462.1 PTPc 34..134 CDD:304379 29/108 (27%)
CDC14 <61..146 CDD:225297 26/82 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1720
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.