DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdc14 and cdkn3

DIOPT Version :10

Sequence 1:NP_609153.1 Gene:Cdc14 / 34067 FlyBaseID:FBgn0031952 Length:1052 Species:Drosophila melanogaster
Sequence 2:NP_001139153.1 Gene:cdkn3 / 402796 ZFINID:ZDB-GENE-060427-2 Length:208 Species:Danio rerio


Alignment Length:70 Identity:22/70 - (31%)
Similarity:32/70 - (45%) Gaps:11/70 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   254 FIDGSTPS----DAIMKKFLSICETTKGAIAVHCKAGLGRTGSLIGAYIMKHYGF-----TALEA 309
            |.||..|.    ..:::: |..|...:....:||..||||:| ||.|.::.....     ||||.
Zfish   103 FPDGGAPELYQCSCVLEE-LKDCLQNQRRTVIHCYGGLGRSG-LIAACLLLQLSVSMTPSTALEI 165

  Fly   310 IAWLR 314
            :..||
Zfish   166 LRELR 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdc14NP_609153.1 CDC14_N 12..158 CDD:350495
CDC14_C 167..341 CDD:350349 22/70 (31%)
cdkn3NP_001139153.1 CDKN3-like 24..186 CDD:350355 22/70 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.