DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cdc14 and Ptpmt1

DIOPT Version :9

Sequence 1:NP_001285721.1 Gene:cdc14 / 34067 FlyBaseID:FBgn0031952 Length:1052 Species:Drosophila melanogaster
Sequence 2:NP_001099196.1 Gene:Ptpmt1 / 29390 RGDID:1589783 Length:251 Species:Rattus norvegicus


Alignment Length:106 Identity:29/106 - (27%)
Similarity:54/106 - (50%) Gaps:15/106 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 DNNVTTVIRLNAKVYH-------ASSFENAGFDHKDLFFID-GSTPSDAIMKK---FLSICETTK 276
            |.||..||.:|.: |.       :..::|.|.:...|..:| ...|:.|.:.:   |....::..
  Rat   120 DENVRGVITMNEE-YETRFLCNTSKEWKNVGVEQLRLSTVDMTGVPTLANLHRGVQFALKYQSLG 183

  Fly   277 GAIAVHCKAGLGRTGSLIGAYIMKHYGFT---ALEAIAWLR 314
            ..:.||||||..|:.:::.||:::.:.::   |:||||.:|
  Rat   184 QCVYVHCKAGRSRSATMVAAYLIQVHNWSPEEAIEAIAKIR 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cdc14NP_001285721.1 DSPn 19..156 CDD:291343
PTPc 217..331 CDD:304379 29/106 (27%)
CDC14 <229..330 CDD:225297 26/100 (26%)
Ptpmt1NP_001099196.1 PTPc 139..240 CDD:304379 22/86 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1386941at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.