DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cdc14 and Ptpdc1

DIOPT Version :9

Sequence 1:NP_001285721.1 Gene:cdc14 / 34067 FlyBaseID:FBgn0031952 Length:1052 Species:Drosophila melanogaster
Sequence 2:NP_001099574.1 Gene:Ptpdc1 / 291022 RGDID:1307698 Length:751 Species:Rattus norvegicus


Alignment Length:475 Identity:104/475 - (21%)
Similarity:174/475 - (36%) Gaps:120/475 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 ERVENGDFNWIVPQKFIAFCGPHQKSKTLPNGYPCHAPERYFSYFRDNNVTTVIRLNAKVYHAS- 240
            |:...|.::..|....:|...|   |..|...|  |..|::.|:    .:.|:|.|.....||| 
  Rat    75 EQAIKGVYSSWVTDNILAMARP---SSELLEKY--HIIEQFLSH----GIKTIINLQRPGEHASC 130

  Fly   241 ---------------SFENAG-----FDHKDLFFIDGSTPSDAI--MKKFLSICETTKGAIAVHC 283
                           :|..||     |..||.    |.....||  |.|.::.. ..:|.:||||
  Rat   131 GNSLEQESGFTYLPEAFMEAGIYFYNFGWKDY----GVASLTAILDMVKVMTFA-LQEGKVAVHC 190

  Fly   284 KAGLGRTGSLIGAYIMKHYGFTALEAIAWLRLCRPGSVIGHQQ--------QWM----------E 330
            .|||||||.||..|::.....||.:||.::|..||.|:....|        |::          :
  Rat   191 HAGLGRTGVLIACYLVFATRMTADQAIIFVRAKRPNSIQTRGQLLCVREFTQFLAPLRNIFSCCD 255

  Fly   331 DKQSWLWSEGERMRRRTSLPILQHTYGINSLELKKKLASAAA----DSTEHVDLLLTRVKGISQR 391
            .|...:......||:|.    |.|.|....|:...|:.....    |..|:..:::..|.     
  Rat   256 PKAHAVTLAQYLMRQRH----LLHGYEARLLKYVPKIVHLVCKLLLDVAENRPVVMKSVL----- 311

  Fly   392 VDTMHLNDQDNLDAACTDQTDEELSEQLRLERDERALYQSVE-----DPNCNNSDDNDTDTISA- 450
                   :...|.|    :.::.:||.:.::.|:..|.|:.:     :|....::.:..|.|.: 
  Rat   312 -------EGPELSA----EIEKTVSEMVTMQLDQELLRQNSDVPDPFNPTAEVAEFDSQDVILSN 365

  Fly   451 --PADP-----------PPTS-----SYTISTRRRKSPSGANKPTVIATSLRRLVNPNANRSGLS 497
              ..||           |.|.     ||:.|..:|.........|......:.|::.:..:...:
  Rat   366 EHEFDPLWKRRNIERLQPLTHLKRQLSYSDSDLKRAKAILEQGETPWTVPAQELLDHSLQQQTPT 430

  Fly   498 TASGVYPTPELASCTEKKLRKPSANVFEAARHTIASTVRMTQTALEKKQAQTQGDKL----NQIK 558
            :...:.|||||.      |.|.:     ..|:|.:.........||  :.:.:|..|    :..|
  Rat   431 SHCFLPPTPELG------LHKDT-----LVRNTFSFWTESKCGGLE--EPKDEGSLLLCRKDSPK 482

  Fly   559 ALRRHHSRSVNVNSNSSEQE 578
            .::|..:.||.|:.:.:..|
  Rat   483 EVQRSRTFSVGVSCSHNPGE 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cdc14NP_001285721.1 DSPn 19..156 CDD:291343
PTPc 217..331 CDD:304379 43/154 (28%)
CDC14 <229..330 CDD:225297 41/141 (29%)
Ptpdc1NP_001099574.1 PTPc 113..226 CDD:304379 38/121 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1720
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.