DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cdc14 and Cdkn3

DIOPT Version :9

Sequence 1:NP_001285721.1 Gene:cdc14 / 34067 FlyBaseID:FBgn0031952 Length:1052 Species:Drosophila melanogaster
Sequence 2:XP_006251853.1 Gene:Cdkn3 / 289993 RGDID:1307781 Length:212 Species:Rattus norvegicus


Alignment Length:104 Identity:28/104 - (26%)
Similarity:44/104 - (42%) Gaps:13/104 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   256 DGSTPSDA----IMKKFLSICETTKGAIAVHCKAGLGRTGSLIGAYIMKHY--GFTALEAIAWLR 314
            ||.||...    ||:: |:.|........:||..||||: .|:.|.::.:.  ..:..:||..||
  Rat   110 DGGTPDIGSCWEIMEE-LATCLKNNRKTLIHCYGGLGRS-CLVAACLLLYLSDSISPQQAIDSLR 172

  Fly   315 LCRPGSVIGHQQQW-----MEDKQSWLWSEGERMRRRTS 348
            ..|....|...:|:     ..||.:...|..:.:.|..|
  Rat   173 DVRGSGAIQTIKQYNYLHEFRDKLAAYLSSRDSLSRSVS 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cdc14NP_001285721.1 DSPn 19..156 CDD:291343
PTPc 217..331 CDD:304379 23/85 (27%)
CDC14 <229..330 CDD:225297 23/84 (27%)
Cdkn3XP_006251853.1 CDKN3 1..168 CDD:203311 16/59 (27%)
CDC14 <100..192 CDD:225297 23/83 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1720
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.