DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cdc14 and T12B3.1

DIOPT Version :9

Sequence 1:NP_001285721.1 Gene:cdc14 / 34067 FlyBaseID:FBgn0031952 Length:1052 Species:Drosophila melanogaster
Sequence 2:NP_501178.1 Gene:T12B3.1 / 177510 WormBaseID:WBGene00020444 Length:446 Species:Caenorhabditis elegans


Alignment Length:253 Identity:59/253 - (23%)
Similarity:92/253 - (36%) Gaps:82/253 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 SMNPAKRLNAAYLIG---SYAIIYLNKTPQEA----YRPLVAGEIPAYTRFCDASYGPSNFKISL 147
            |:.|..:....|..|   .:.|:...:|..:|    |...:..:|.|..|          .::..
 Worm    34 SLTPGDQKCRLYCSGPRCRFCIVVTGQTEIQAIDGLYSTWITSDILAMAR----------LQVEH 88

  Fly   148 LDCLNAVHK----GLQAGFFNFNDFDAEEYEYFERVENGDFNWIVPQKFIAFCGPHQKSKTLPNG 208
            .|.|..|.|    |:|: ..|..             |:|:.         :|||    |..|.:|
 Worm    89 FDSLGIVEKFKTNGIQS-VINLQ-------------ESGEH---------SFCG----SGNLTSG 126

  Fly   209 YPCHAPERYFSYFRDNNVTTVIRLNAKVYHASSFENAGFDHKDLFFIDGSTPSDAIMKKFLSICE 273
                     |||..:|      .:...:||.:      |...|   ....||:     :.|.|.:
 Worm   127 ---------FSYDPEN------LMRNGIYHYN------FPLPD---FQACTPN-----RLLDIVK 162

  Fly   274 T-----TKGAIAVHCKAGLGRTGSLIGAYIMKHYGFTALEAIAWLRLCRPGSVIGHQQ 326
            .     :.|.|||||.||.||||.:|.|::|...|.:..:|:..:|..|..:|...:|
 Worm   163 VVDFALSHGKIAVHCHAGHGRTGMVIAAWMMYALGMSPSQAVDTVRSRRAKAVQSKEQ 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cdc14NP_001285721.1 DSPn 19..156 CDD:291343 14/72 (19%)
PTPc 217..331 CDD:304379 33/115 (29%)
CDC14 <229..330 CDD:225297 29/103 (28%)
T12B3.1NP_501178.1 PTP_PTPDC1 64..252 CDD:350356 53/223 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1720
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.