DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdc14 and CDKN3

DIOPT Version :10

Sequence 1:NP_609153.1 Gene:Cdc14 / 34067 FlyBaseID:FBgn0031952 Length:1052 Species:Drosophila melanogaster
Sequence 2:NP_005183.2 Gene:CDKN3 / 1033 HGNCID:1791 Length:212 Species:Homo sapiens


Alignment Length:79 Identity:25/79 - (31%)
Similarity:37/79 - (46%) Gaps:8/79 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   256 DGSTPSDA----IMKKFLSICETTKGAIAVHCKAGLGRTGSLIGAYIMKHYGFTAL--EAIAWLR 314
            ||.||..|    ||:: |:.|........:||..||||: .|:.|.::.:...|..  :||..||
Human   110 DGGTPDIASCCEIMEE-LTTCLKNYRKTLIHCYGGLGRS-CLVAACLLLYLSDTISPEQAIDSLR 172

  Fly   315 LCRPGSVIGHQQQW 328
            ..|....|...:|:
Human   173 DLRGSGAIQTIKQY 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdc14NP_609153.1 CDC14_N 12..158 CDD:350495
CDC14_C 167..341 CDD:350349 25/79 (32%)
CDKN3NP_005183.2 CDKN3 1..168 CDD:399018 18/59 (31%)
Interaction with CDK2 1..34
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.