Protein Alignment cdc14 and CDKN3

DIOPT Version :9

• Sequence 1: NP_001285721.1
• Gene: cdc14 / 34067
• FlyBaseID: FBgn0031952
• Length: 1052
• Species: Drosophila melanogaster
• Sequence 2: NP_005183.2
• Gene: CDKN3 / 1033
• HGNCID: 1791
• Length: 212
• Species: Homo sapiens
• Alignment Length: 79
• Identity: 25/79 - (31%)
• Similarity: 37/79 - (46%)
• Gaps: 8/79 - (10%)

  Fly   256 DGSTPSDA----IMKKFLSICETTKGAIAVHCKAGLGRTGSLIGAYIMKHYGFTAL--EAIAWLR 314
            ||.||..|    ||:: |:.|........:||..||||: .|:.|.::.:...|..  :||..||
Human   110 DGGTPDIASCCEIMEE-LTTCLKNYRKTLIHCYGGLGRS-CLVAACLLLYLSDTISPEQAIDSLR 172

  Fly   315 LCRPGSVIGHQQQW 328
            ..|....|...:|:
Human   173 DLRGSGAIQTIKQY 186

Known Domains

Gene	Sequence	Domain	Region	External ID	Identity
cdc14	NP_001285721.1	DSPn	19..156	CDD:291343
		PTPc	217..331	CDD:304379	25/79 (32%)
		CDC14	<229..330	CDD:225297	25/79 (32%)
CDKN3	NP_005183.2	CDKN3	1..168	CDD:203311	18/59 (31%)
		Interaction with CDK2	1..34
		Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite	1..20

Information from Original Tools

Tool	Simple Score	Weighted Score	Original Tool Information
			BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG1720
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.810