DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment r2d2 and PRKRA

DIOPT Version :10

Sequence 1:NP_609152.1 Gene:r2d2 / 34066 FlyBaseID:FBgn0031951 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_003681.1 Gene:PRKRA / 8575 HGNCID:9438 Length:313 Species:Homo sapiens


Alignment Length:182 Identity:47/182 - (25%)
Similarity:80/182 - (43%) Gaps:30/182 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KSAVSALQEF-----------CART--QINLPTYSFIPGEDGGYVCKVELLEIEALGNGRSKRDA 55
            |:.:..|.|:           |.|:  ||::||::|          :|.:.:|...|.|.||:.|
Human    33 KTPIQVLHEYGMKTKNIPVYECERSDVQIHVPTFTF----------RVTVGDITCTGEGTSKKLA 87

  Fly    56 KHLAASNILRKIQLLPGIHGLMKDSTVGDLDEELTN-LNRDMVKELRDYCVRREMPLPCIEVVQQ 119
            ||.||...:..::....|...:.|..:.|..::..| ||  .:..|::..:.....||...:.|:
Human    88 KHRAAEAAINILKANASICFAVPDPLMPDPSKQPKNQLN--PIGSLQELAIHHGWRLPEYTLSQE 150

  Fly   120 SGTPSAPEFVACCSVASIVRYGKSDKKKDARQRAAIEMLALISSNSDNLRPD 171
            .|.....|:...|.:.|.:..||...||.|::.||.:.||..|    |:.|:
Human   151 GGPAHKREYTTICRLESFMETGKGASKKQAKRNAAEKFLAKFS----NISPE 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
r2d2NP_609152.1 DSRM 6..68 CDD:214634 20/74 (27%)
DSRM_SF 102..158 CDD:380679 14/55 (25%)
PRKRANP_003681.1 Sufficient for self-association and interaction with TARBP2 1..103 21/79 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
DSRM_PRKRA_rpt1 32..102 CDD:380718 21/78 (27%)
Sufficient for self-association and interaction with TARBP2 102..195 24/98 (24%)
DSRM_PRKRA_rpt2 126..192 CDD:380720 18/67 (27%)
Sufficient for self-association and interaction with TARBP2 195..313 1/4 (25%)
DSRM_PRKRA_rpt3 239..310 CDD:380721
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.