DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment r2d2 and stau2

DIOPT Version :9

Sequence 1:NP_001162903.1 Gene:r2d2 / 34066 FlyBaseID:FBgn0031951 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001011376.2 Gene:stau2 / 496843 XenbaseID:XB-GENE-491508 Length:706 Species:Xenopus tropicalis


Alignment Length:315 Identity:64/315 - (20%)
Similarity:112/315 - (35%) Gaps:106/315 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 NKSAVSALQEFCARTQINLPTYSFIPGEDGG------YVCKVELLEIEALGNGRSKRDAKHLAAS 61
            |||.:|.:.|...:..::|   ||...::.|      :|.:|.:.|..|.|.|.||:.||..||:
 Frog   305 NKSEISLVFEISLKRNLSL---SFEVIKESGPPHMKSFVTRVTVGEFTAEGEGNSKKLAKRRAAA 366

  Fly    62 NILRKIQLLPGIHGLMKDSTVGDLDEELTNLNRDMVKELRDYCVRREM--------------PLP 112
            .:|::::.||.:                     .::::.|.|..||..              |:.
 Frog   367 AVLQELRKLPPL---------------------PVIEKPRIYIKRRPKNIIKASPEYGQGMNPIS 410

  Fly   113 CIEVVQQSGTPSAP--------------EFVACCSVASIVRYGKSDKKKDARQRAAIEMLALISS 163
            .:..:||:.....|              |||....|......|....||.|::.||..||     
 Frog   411 RLAQIQQAKKEKEPEYVLLSERGIQRRREFVMQVKVGEETATGTGPNKKTAKRNAAEAML----- 470

  Fly   164 NSDNLRPDQMQVASTSKLKVVDMEESMEELEALRRKKFTTYWELKEAGSVDHTGMRLCDRHNYFK 228
                     :|:...:...||         |...::.....|:.:.:|..|.|.           
 Frog   471 ---------LQLGYKASSPVV---------EKTGKRGENPDWDEQNSGIADQTS----------- 506

  Fly   229 NFYPTLKKEAIEAINSDEY---ESSKDK-----AMDVMSSLKITPKISEVESSSL 275
                  ..:.|..::.|.|   |:|::|     |:..:||.::....|...|:|:
 Frog   507 ------TPKGILHLSPDVYQEMEASRNKTVPAPAISYLSSKEMNQASSSFFSTSV 555

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
r2d2NP_001162903.1 DSRM 6..67 CDD:238007 19/66 (29%)
DSRM 95..158 CDD:238007 18/90 (20%)
stau2NP_001011376.2 DSRM 91..152 CDD:214634
DSRM 196..279 CDD:214634
DSRM 309..>356 CDD:214634 12/49 (24%)
DSRM 408..474 CDD:214634 17/79 (22%)
Staufen_C 559..660 CDD:293091
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.