DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment r2d2 and stau

DIOPT Version :9

Sequence 1:NP_001162903.1 Gene:r2d2 / 34066 FlyBaseID:FBgn0031951 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_476751.1 Gene:stau / 37065 FlyBaseID:FBgn0003520 Length:1026 Species:Drosophila melanogaster


Alignment Length:326 Identity:69/326 - (21%)
Similarity:134/326 - (41%) Gaps:88/326 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 LGNGRSKRDAKHLAASNILR--KIQLLPGIHGLMKDSTVGDLDEELTNLNRDMVKELRDYCVRRE 108
            :|.||:.:.|||.||:..|:  |.|.:......::||    :||   ...:..:.::.:..::|.
  Fly   534 VGIGRTLQQAKHDAAARALQVL
KTQAISASEEALEDS----MDE---GDKKSPISQVHEIGIKRN 591

  Fly   109 MPLPCIEVVQQSGTPSAPEFVACCSVASIVRYGKSDKKKDARQRAAIEML--------------- 158
            |.:. .:|:::.|......|:..|.|.|||..|:.:.||.:::|||.:||               
  Fly   592 MTVH-FKVLREEGPAHMKNFITACIVGSIVTEGEGNGKKVSKKRAAEKMLVELQKLPPLTPTKQT 655

  Fly   159 -------------------ALISSNSDNL----RPDQMQVASTSKLKVVDME------------- 187
                               ..:.|.:|..    :|::.:..:..|.|::||:             
  Fly   656 PLKRIKVKTPGKSGAAAREGSVVSGTDGPTQTGKPERRKRLNPPKDKLIDMDDADNPITKLIQLQ 720

  Fly   188 ------ESMEEL------EALRRKKFTTYWELKEAGSVDH-TG--MRLCDRHNYFKNFYPTLKKE 237
                  |.:.||      |..||::|.  .|:..:||... ||  .:|..| |..:..:..|  |
  Fly   721 QTRKEKEPIFELIAKNGNETARRREFV--MEVSASGSTARGTGNSKKLAKR-NAAQALFELL--E 780

  Fly   238 AIEAINSDEYESSKDKAMDVMSSLKITPKISEVESSSLVPLLSVELNCAFDVVLM------AKET 296
            |::...::|.:||::.:.....|....|.: |..:...||:::..:.....::::      ||:.
  Fly   781 AVQVTPTNETQSSEECSTSATMSAVTAPAV-EATAEGKVPMVATPVGPMPGILILRQNKKPAKKR 844

  Fly   297 D 297
            |
  Fly   845 D 845

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
r2d2NP_001162903.1 DSRM 6..67 CDD:238007 9/22 (41%)
DSRM 95..158 CDD:238007 16/62 (26%)
stauNP_476751.1 DSRM 312..375 CDD:214634
DSRM <529..555 CDD:294045 9/20 (45%)
DSRM 579..644 CDD:214634 18/65 (28%)
DSRM 712..780 CDD:214634 16/72 (22%)
Staufen_C <953..1020 CDD:293091
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3732
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6775
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.760

Return to query results.
Submit another query.