DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment r2d2 and stau1

DIOPT Version :9

Sequence 1:NP_001162903.1 Gene:r2d2 / 34066 FlyBaseID:FBgn0031951 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_991124.2 Gene:stau1 / 334440 ZFINID:ZDB-GENE-030131-6372 Length:702 Species:Danio rerio


Alignment Length:190 Identity:45/190 - (23%)
Similarity:87/190 - (45%) Gaps:42/190 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 GNGRSKRDAKHLAASNILRKIQLLPGIHGL--MKDSTVGDLDEELTNLNRDMVKELRDYCVRREM 109
            |.||:::.|||.||:..::.:|..|.:..:  |.|....:      |||:..:.::.:..::|.|
Zfish   241 GKGRTRQAAKHDAAAKAIKYLQKEPILQQITEMTDEPAQE------NLNKSEISQVFEIALKRNM 299

  Fly   110 PLPCIEVVQQSGTPSAPEFVACCSVASIVRYGKSDKKKDARQRAAIEMLALISSNSDNLR--PDQ 172
            |:. .||::::|.|....||....|......|:...||.|:::|||.:|       :.||  |  
Zfish   300 PVD-FEVLKEAGAPHMKSFVVRVVVGEFAGEGEGKSKKIAKKQAAIAVL-------EELRRLP-- 354

  Fly   173 MQVASTSKL---------KVVDMEESME------------ELEALRRKKFTTYWELKEAG 211
             |:.:|.|:         .::.::.|.|            :::..:::|...|..:.|.|
Zfish   355 -QLPATDKIPLRIKKKSKSIIKLQTSPEYGQGMNPISRLAQIQQAKKEKEPEYTLVTERG 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
r2d2NP_001162903.1 DSRM 6..67 CDD:238007 8/19 (42%)
DSRM 95..158 CDD:238007 17/62 (27%)
stau1NP_991124.2 DSRM 75..138 CDD:214634
DSRM 287..350 CDD:214634 18/70 (26%)
DSRM 387..453 CDD:238007 4/27 (15%)
Staufen_C 551..660 CDD:293091
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3732
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.