DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment r2d2 and Prkra

DIOPT Version :9

Sequence 1:NP_001162903.1 Gene:r2d2 / 34066 FlyBaseID:FBgn0031951 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001019951.1 Gene:Prkra / 311130 RGDID:1306707 Length:313 Species:Rattus norvegicus


Alignment Length:182 Identity:46/182 - (25%)
Similarity:80/182 - (43%) Gaps:30/182 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KSAVSALQEF-----------CART--QINLPTYSFIPGEDGGYVCKVELLEIEALGNGRSKRDA 55
            |:.:..|.|:           |.|:  |:::||::|          :|.:.:|...|.|.||:.|
  Rat    33 KTPIQVLHEYGTKTKNIPVYECERSDVQVHVPTFTF----------RVTVGDITCTGEGTSKKLA 87

  Fly    56 KHLAASNILRKIQLLPGIHGLMKDSTVGDLDEELTN-LNRDMVKELRDYCVRREMPLPCIEVVQQ 119
            ||.||...:..::....|...:.|..:.|..::..| ||  .:..|::..:.....||...:.|:
  Rat    88 KHRAAEAAINILKANASICFAVPDPLMPDPSKQPKNQLN--PIGSLQELAIHHGWRLPEYTLSQE 150

  Fly   120 SGTPSAPEFVACCSVASIVRYGKSDKKKDARQRAAIEMLALISSNSDNLRPD 171
            .|.....|:...|.:.|.:..||...||.|::.||.:.||..|    |:.|:
  Rat   151 GGPAHKREYTTICRLESFMETGKGASKKQAKRNAAEKFLAKFS----NISPE 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
r2d2NP_001162903.1 DSRM 6..67 CDD:238007 19/73 (26%)
DSRM 95..158 CDD:238007 15/62 (24%)
PrkraNP_001019951.1 Sufficient for self-association and interaction with TARBP2. /evidence=ECO:0000250 1..103 20/79 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
DSRM 35..100 CDD:214634 19/74 (26%)
Sufficient for self-association and interaction with TARBP2. /evidence=ECO:0000250 102..195 24/98 (24%)
DSRM 126..192 CDD:238007 18/67 (27%)
Sufficient for self-association and interaction with TARBP2. /evidence=ECO:0000250 195..313 1/4 (25%)
DSRM 241..307 CDD:214634
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3732
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1093169at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46205
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.