DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment r2d2 and Stau2

DIOPT Version :9

Sequence 1:NP_001162903.1 Gene:r2d2 / 34066 FlyBaseID:FBgn0031951 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_079579.2 Gene:Stau2 / 29819 MGIID:1352508 Length:570 Species:Mus musculus


Alignment Length:186 Identity:46/186 - (24%)
Similarity:85/186 - (45%) Gaps:26/186 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 EALGNGRSKRDAKHLAASNILRKIQLLPGIHGLMKDSTVG-DLDEELTNLNRDMVKELRDYCVRR 107
            |..|.|::::.|:|.||...|:.:|..|......::...| ::|:: .:.|:..:..:.:..::|
Mouse   156 EFFGEGKTRQAARHNAAMKALQALQNEPIPEKSPQNGESGKEMDDD-KD
ANKSEISLVFEIALKR 219

  Fly   108 EMPLPCIEVVQQSGTPSAPEFVACCSVASIVRYGKSDKKKDARQRAAIEMLALISSNSDNLRPDQ 172
            .||: ..||:::||.|....||...||......|:.:.||.:::|||..:|..:.    .|.|  
Mouse   220 NMPV-SFEVIKESGPPHMKSFVTRVSVGEFSAEGEGNSKKLSKKRAATTVLQELK----KLPP-- 277

  Fly   173 MQVASTSKL------KVV-----DMEESME------ELEALRRKKFTTYWELKEAG 211
            :.|....||      |.:     |..:.|.      :::..|::|...|..|.|.|
Mouse   278 LPVVEKPKLFFKKRPKTIVKAGPDYGQGMNPISRLAQIQQARKEKEPDYILLSERG 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
r2d2NP_001162903.1 DSRM 6..67 CDD:238007 8/22 (36%)
DSRM 95..158 CDD:238007 18/62 (29%)
Stau2NP_079579.2 DSRM_STAU2_rpt1 3..70 CDD:380709
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 71..94
DSRM_STAU2_rpt2 98..179 CDD:380711 8/22 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 178..203 4/25 (16%)
DSRM_STAU2_rpt3 206..272 CDD:380713 19/66 (29%)
Nuclear localization signal 1 273..291 5/23 (22%)
DSRM_STAU2_rpt4 304..389 CDD:380715 7/30 (23%)
Nuclear localization signal 2. /evidence=ECO:0000250 373..412
Required for dendritic transport. /evidence=ECO:0000250 381..570
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 381..413
Staufen_C 465..523 CDD:374568
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 545..570
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3732
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6775
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.760

Return to query results.
Submit another query.