DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment r2d2 and Prkra

DIOPT Version :9

Sequence 1:NP_001162903.1 Gene:r2d2 / 34066 FlyBaseID:FBgn0031951 Length:311 Species:Drosophila melanogaster
Sequence 2:XP_030106794.1 Gene:Prkra / 23992 MGIID:1344375 Length:365 Species:Mus musculus


Alignment Length:182 Identity:46/182 - (25%)
Similarity:80/182 - (43%) Gaps:30/182 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KSAVSALQEF-----------CART--QINLPTYSFIPGEDGGYVCKVELLEIEALGNGRSKRDA 55
            |:.:..|.|:           |.|:  |:::||::|          :|.:.:|...|.|.||:.|
Mouse   114 KTPIQVLHEYGMKTKNIPVYECERSDVQVHVPTFTF----------RVTVGDITCTGEGTSKKLA 168

  Fly    56 KHLAASNILRKIQLLPGIHGLMKDSTVGDLDEELTN-LNRDMVKELRDYCVRREMPLPCIEVVQQ 119
            ||.||...:..::....|...:.|..:.|..::..| ||  .:..|::..:.....||...:.|:
Mouse   169 KHRAAEAAINILKANASICFAVPDPLMPDPSKQPKNQLN--PIGSLQELAIHHGWRLPEYTLSQE 231

  Fly   120 SGTPSAPEFVACCSVASIVRYGKSDKKKDARQRAAIEMLALISSNSDNLRPD 171
            .|.....|:...|.:.|.:..||...||.|::.||.:.||..|    |:.|:
Mouse   232 GGPAHKREYTTICRLESFMETGKGASKKQAKRNAAEKFLAKFS----NISPE 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
r2d2NP_001162903.1 DSRM 6..67 CDD:238007 19/73 (26%)
DSRM 95..158 CDD:238007 15/62 (24%)
PrkraXP_030106794.1 DSRM_PRKRA_rpt1 113..183 CDD:380718 20/78 (26%)
DSRM_PRKRA_rpt2 207..273 CDD:380720 18/67 (27%)
DSRM_SF 320..>350 CDD:381777
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3732
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46205
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.