DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment r2d2 and Stau1

DIOPT Version :9

Sequence 1:NP_001162903.1 Gene:r2d2 / 34066 FlyBaseID:FBgn0031951 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001103376.1 Gene:Stau1 / 20853 MGIID:1338864 Length:495 Species:Mus musculus


Alignment Length:223 Identity:54/223 - (24%)
Similarity:94/223 - (42%) Gaps:40/223 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 TYSFIPGEDGG-------YVCKVE--LLEIEAL-------GNGRSKRDAKHLAASNILRKIQLLP 71
            |||:  |..||       |...|.  |.::|..       |.|:.:...||.|.:..||.:|..|
Mouse    14 TYSY--GMRGGAYPPRYFYPFPVPPLLYQVELSVGGQQFNGKGKMRPPVKHDAPARALRTLQSEP 76

  Fly    72 GIHGLMKDSTVGDLDEELTNLNRDMVKELRDYCVRREMPLP-----CIEVVQQSGTPSAPEFVAC 131
                |.:...|...:.|..|||:..:.::.:..::|.:|:.     ..:|.::||.|....||..
Mouse    77 ----LPERLEVNGREAEEENLNKSEISQVFEIALKRNLPVNFESFLLTQVARESGPPHMKNFVTR 137

  Fly   132 CSVASIVRYGKSDKKKDARQ---RAAIEMLALIS--SNSDNLRPD-QMQVASTSKLKVV-DMEES 189
            .||...|..|:...||.:::   ||.:|.|..:.  ...:.::|. :.:...|.||:.. |..:.
Mouse   138 VSVGEFVGEGEGKSKKISKKNAARAVLEQLRRLPPLPAVERVKPRIKKKSQPTCKLQTAPDYGQG 202

  Fly   190 ME------ELEALRRKKFTTYWELKEAG 211
            |.      :::..:::|...|..|.|.|
Mouse   203 MNPISRLAQIQQAKKEKEPEYMLLTERG 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
r2d2NP_001162903.1 DSRM 6..67 CDD:238007 17/59 (29%)
DSRM 95..158 CDD:238007 17/70 (24%)
Stau1NP_001103376.1 DSRM 98..167 CDD:214634 17/68 (25%)
DSRM 204..270 CDD:238007 5/27 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 278..318
Staufen_C 366..475 CDD:293091
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3732
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.