DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment r2d2 and prkra

DIOPT Version :9

Sequence 1:NP_001162903.1 Gene:r2d2 / 34066 FlyBaseID:FBgn0031951 Length:311 Species:Drosophila melanogaster
Sequence 2:XP_004917795.2 Gene:prkra / 100379994 XenbaseID:XB-GENE-940706 Length:312 Species:Xenopus tropicalis


Alignment Length:260 Identity:63/260 - (24%)
Similarity:107/260 - (41%) Gaps:46/260 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KSAVSALQEFCARTQINLPTYSFIPGE----DGGYVCKVELLEIEALGNGRSKRDAKHLAASNIL 64
            |:.:..|.||..:|. |.|.|:.|..|    :..:..::.:.:|.:.|.|.||:.||..||.:.|
 Frog    30 KTPIQQLHEFGTKTG-NPPVYTLIKAEGEVHNPSFTFRLVIGDIVSSGEGPSKKAAKQKAAESAL 93

  Fly    65 RKIQLLPGIHG--LMKDSTVGDLDEE-LTNLNRDMVKELRDYCVRREMPLPCIEVVQQSGTPSAP 126
               .:|.|..|  |...:||.|:.:: |..:..:.|..|::..|::...||...|.|:||.|...
 Frog    94 ---NILQGSTGKCLPVKNTVRDVPKQPLNQMKENPVGSLQELSVQKGWRLPEYTVAQESGPPHER 155

  Fly   127 EFVACCSVASIVRYGKSDKKKDARQRAAIEMLALISSNSDNLRPDQMQVASTSKLKVVDMEESME 191
            ||...|.|.:.|..|....||.|::.||.::|                    :|||.:.::....
 Frog   156 EFTITCRVETFVETGSGTSKKVAKRVAADKLL--------------------TKLKAIPVDNMNI 200

  Fly   192 ELEALRRKKFTTYWELKEAGSVDHTGMRLCDRHNYFKNFYPTLKKEAIEAINSDEYESSKDKAMD 256
            .|..:.....:..|:.....|    |.::|           .||:..:....:|..:...|.|.:
 Frog   201 SLNKVIGNNLSCTWDSMRNSS----GEKIC-----------MLKRSPLSIPYTDYVKMLNDLAKE 250

  Fly   257  256
             Frog   251  250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
r2d2NP_001162903.1 DSRM 6..67 CDD:238007 19/64 (30%)
DSRM 95..158 CDD:238007 21/62 (34%)
prkraXP_004917795.2 DSRM_SF 29..98 CDD:412133 21/71 (30%)
DSRM_PRKRA_rpt2 124..190 CDD:380720 22/85 (26%)
DSRM_PRKRA_rpt3 238..309 CDD:380721 3/13 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1093169at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46205
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.