DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7154 and YBEY

DIOPT Version :9

Sequence 1:NP_609148.1 Gene:CG7154 / 34062 FlyBaseID:FBgn0031947 Length:861 Species:Drosophila melanogaster
Sequence 2:XP_011527936.2 Gene:YBEY / 54059 HGNCID:1299 Length:302 Species:Homo sapiens


Alignment Length:227 Identity:45/227 - (19%)
Similarity:74/227 - (32%) Gaps:88/227 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 KKDREKKHK---HHKEKRHRSRDRH-RDAGSDEDMMAGADDAACSGFAPSSVAPPAADPDSSQDG 153
            :||..:||:   .|...|...|.|. ..:||          .:.:||.|:...|           
Human    42 RKDLRRKHRLLPRHSALRTAGRKRRGPTSGS----------LSTTGFRPARCDP----------- 85

  Fly   154 FSFMDDDQSQPLPENILFFAGITTDNSPSNCPVTKPIAPRKLDDILMGSSPNSSSLQSSSLGLIG 218
                     .|||          |..|.:..||.:   .|.|...|:|  |::.|:.:...||: 
Human    86 ---------VPLP----------TTRSVAGLPVGR---VRPLSRPLLG--PDTGSVANIFKGLV- 125

  Fly   219 SSPTKPLPDLLIPSPSTPGGANSLNALTPKALEAPKTPSSSSESGREPRSCVLKLKQ-----QKS 278
                      ::|..|..  ..:|..:.|              ..|.|....:::.:     ||.
Human   126 ----------ILPEMSLV--IRNLQRVIP--------------IRRAPLRSKIEIVRRILGVQKF 164

  Fly   279 PL------NKLLEHLLRFLEKRD-PHQFFAWP 303
            .|      ||.::|:.|....|: |....::|
Human   165 DLGIICVDNKNIQHINRIYRDRNVPTDVLSFP 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7154NP_609148.1 Bromo_brd7_like 279..376 CDD:99945 8/32 (25%)
DUF3512 440..687 CDD:288847
YBEYXP_011527936.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159925
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.