DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7179 and Cdcp2

DIOPT Version :10

Sequence 1:NP_723315.3 Gene:CG7179 / 34059 FlyBaseID:FBgn0020880 Length:696 Species:Drosophila melanogaster
Sequence 2:XP_038967409.1 Gene:Cdcp2 / 298306 RGDID:1563467 Length:566 Species:Rattus norvegicus


Alignment Length:219 Identity:55/219 - (25%)
Similarity:81/219 - (36%) Gaps:59/219 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 CGLHGVYRQRQSLVESPNYPDNYPVNTCWDYVVRSPYRCPTKFHIQFLDFKLELSENCSRDYLAI 93
            ||  ||......::.||.||:|||.|....:::|:  ..|....:.|:||::|.||.|..|::.:
  Rat   171 CG--GVLTGLSGILSSPEYPNNYPNNVECHWLIRA--SGPATVKLVFVDFQVEGSEECMYDHVTV 231

  Fly    94 -------------------GLNNDGDDMEVLCGQVLGIK----KYHTPDG-------VLRLRFLS 128
                               .|.:.|.:::|:......|.    |.|...|       .:|..|.|
  Rat   232 LGAPGPAHGHHYCGSTRPPTLVSLGHELQVVFKSDFNIGGRGFKAHYFSGECQEVFTAVRGNFSS 296

  Fly   129 DDSP----------WTTN--GGFR--LLITRLACEREDLVARGLDDDE-EDVDGDTVQVSAKSPP 178
            ...|          ||..  .|:|  :.:..|..|..:.:.|..|.|. ...||       .|..
  Rat   297 PQYPGAYPNNIRCHWTIRLPPGYRVKVFVLDLGLEEPNSLTRTCDFDHLAAFDG-------ASEE 354

  Fly   179 KKLLTQHHHHHLP---QQSHQPQL 199
            .|||.:...||||   ..||...|
  Rat   355 AKLLGKWCGHHLPPPVTSSHNQLL 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7179NP_723315.3 CUB 42..141 CDD:214483 33/142 (23%)
Cdcp2XP_038967409.1 CUB 56..167 CDD:238001
CUB 171..280 CDD:238001 28/112 (25%)
CUB 283..396 CDD:238001 26/103 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.