DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7179 and Tnfaip6

DIOPT Version :9

Sequence 1:NP_723315.3 Gene:CG7179 / 34059 FlyBaseID:FBgn0020880 Length:696 Species:Drosophila melanogaster
Sequence 2:NP_033424.1 Gene:Tnfaip6 / 21930 MGIID:1195266 Length:275 Species:Mus musculus


Alignment Length:120 Identity:38/120 - (31%)
Similarity:59/120 - (49%) Gaps:17/120 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 QCGLHGVYRQRQSLVESPNYPDNYPVNTCWDYVVRSPYRCPTKFHIQFLDFKLELSENCSRDYLA 92
            :||  ||:...:.:.:||.:|:.|..|....:.:|..|  ..:.|:.||||.||....|..||:.
Mouse   134 ECG--GVFTDPKRIFKSPGFPNEYDDNQVCYWHIRLKY--GQRIHLSFLDFDLEHDPGCLADYVE 194

  Fly    93 IGLNNDGDDMEVLCGQVLGIKKYHTPD------GVLRLRFLSDDSPWTTNGGFRL 141
            |  .:..||:....|:..|.:   .|:      .|:.|:||||.|  .|.|||::
Mouse   195 I--YDSYDDVHGFVGRYCGDE---LPEDIISTGNVMTLKFLSDAS--VTAGGFQI 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7179NP_723315.3 CUB 42..141 CDD:214483 34/104 (33%)
Tnfaip6NP_033424.1 Link_domain_TSG_6_like 36..128 CDD:239592
CUB 135..244 CDD:278839 38/119 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 253..275
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7354
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.