DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7179 and clec-10

DIOPT Version :9

Sequence 1:NP_723315.3 Gene:CG7179 / 34059 FlyBaseID:FBgn0020880 Length:696 Species:Drosophila melanogaster
Sequence 2:NP_493725.2 Gene:clec-10 / 173430 WormBaseID:WBGene00015403 Length:415 Species:Caenorhabditis elegans


Alignment Length:243 Identity:47/243 - (19%)
Similarity:77/243 - (31%) Gaps:100/243 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 SPNYPDNYPVNTCWDYVV----------------RSPYRC--PTKFHIQFLDFKLELSENCSRDY 90
            |..|| |..|..|..|..                |.||.|  ||.:           .::||.:|
 Worm   111 SGGYP-NVQVGQCVYYSTQGVLAGKWISEDCERYRMPYICELPTTY-----------QDSCSYNY 163

  Fly    91 ---------LAIGLNNDGDDMEVLCGQVLGIKKYHTPDGVLRLRFLSDDSPWTTNGGFRLLITRL 146
                     .|:.........|:.||.::.|   |:|:   .|:::.:.:|:..:|.|     ..
 Worm   164 NGYCYTFSSTAVPFVTAQKICELSCGNLVSI---HSPN---ELQYIVNFAPFVDDGYF-----IG 217

  Fly   147 ACEREDLVARGLDDDEEDVDGDTVQVSAKSPPKKLLTQHHHHHLPQQSHQPQLEPAFNYTQPNRL 211
            |..:.:.....|||...|.|                               :::|:|:.    ::
 Worm   218 ATWKNNYSLSWLDDSPWDYD-------------------------------RIDPSFSV----KV 247

  Fly   212 GFNLGLQPGLG--YPGGLYPP-------------PAGLPPQYTPPCAP 244
            |:...:..|:|  ..|..|..             |||:|....||..|
 Worm   248 GYCFTIYTGVGSKITGSWYSVDNWEIPNQYICKIPAGVPCSPAPPVTP 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7179NP_723315.3 CUB 42..141 CDD:214483 27/123 (22%)
clec-10NP_493725.2 CLECT 24..150 CDD:214480 10/39 (26%)
CLECT 163..280 CDD:214480 25/162 (15%)
CUB 302..409 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7354
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.