DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VSIG1 and Ama

DIOPT Version :9

Sequence 1:XP_005262184.1 Gene:VSIG1 / 340547 HGNCID:28675 Length:449 Species:Homo sapiens
Sequence 2:NP_731114.2 Gene:Ama / 40831 FlyBaseID:FBgn0000071 Length:341 Species:Drosophila melanogaster


Alignment Length:338 Identity:78/338 - (23%)
Similarity:127/338 - (37%) Gaps:85/338 - (25%)


- Green bases have known domain annotations that are detailed below.


Human    11 ILSCLAGQV-SVVQVTIPDGF---VNVTVGSNVTLICIYTTTVASREQLSIQWSFFHKKEMEPIS 71
            ::.|||..: ||:...:....   |..:||.:|...|    ||....|||:.|:   |:..|..:
  Fly    18 LIFCLAISLDSVLSAPVISQISKDVVASVGDSVEFNC----TVEEVGQLSVSWA---KRPSESDT 75

Human    72 HSSCLS----------------TEGMEEKAVSQCLKMTHARDARGRCSWTSESPWE--------- 111
            :|..||                |||.:..:.....::.:       ...:...|:|         
  Fly    76 NSVVLSMRNILSLPDQRYNVTVTEGPKTGSAIYTFRIQN-------IEVSDMGPYECQVLVSATE 133

Human   112 --------EGKWPDVEA---VKGTL--DGQQAELQIYFSQGGQAVAIGQFKDR----ITGSNDPG 159
                    :.|.|.|.|   .|.||  :||..||..: :.|.....|...::.    ..|.:...
  Fly   134 KVTKKLSLQIKTPPVIAENTPKSTLVTEGQNLELTCH-ANGFPKPTISWAREHNAVMPAGGHLLA 197

Human   160 NASITISHMQPADSGIYICDVNN---PPDFLGQNQGILNVSVLVKPSKPLCSVQGRPE----TGH 217
            ..::.|..:...|.|.|.|...|   .||     :.::.|.|..:|.   .:|| ||:    ..|
  Fly   198 EPTLRIRSVHRMDRGGYYCIAQNGEGQPD-----KRLIRVEVEFRPQ---IAVQ-RPKIAQMVSH 253

Human   218 TISLSCLSALGTPSPVYYWHK----LEG---RDIVPVKENFNPTTGILVIGNLTNFEQGYYQCTA 275
            :..|.| |..|.|:|...|||    |:.   .::.....:...||.:|.|.::...:.|.|.|.|
  Fly   254 SAELEC-SVQGYPAPTVVWHKNGVPLQSSRHHEVANTASSSGTTTSVLRIDSVGEEDFGDYYCNA 317

Human   276 INRLGNSSCEIDL 288
            .|:||::...:.|
  Fly   318 TNKLGHADARLHL 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VSIG1XP_005262184.1 Ig 97..189 CDD:299845 24/120 (20%)
IG_like 127..198 CDD:214653 16/77 (21%)
IG_like 216..289 CDD:214653 23/80 (29%)
Ig 219..286 CDD:143165 21/73 (29%)
AmaNP_731114.2 I-set 33..143 CDD:254352 21/123 (17%)
Ig 37..127 CDD:299845 21/103 (20%)
IG_like 154..234 CDD:214653 19/85 (22%)
IGc2 161..223 CDD:197706 13/62 (21%)
I-set 254..330 CDD:254352 21/76 (28%)
IGc2 254..322 CDD:197706 19/68 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.