DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VSIG1 and robo1

DIOPT Version :9

Sequence 1:XP_005262184.1 Gene:VSIG1 / 340547 HGNCID:28675 Length:449 Species:Homo sapiens
Sequence 2:NP_476899.1 Gene:robo1 / 37603 FlyBaseID:FBgn0005631 Length:1395 Species:Drosophila melanogaster


Alignment Length:364 Identity:78/364 - (21%)
Similarity:126/364 - (34%) Gaps:119/364 - (32%)


- Green bases have known domain annotations that are detailed below.


Human   109 PWEEGKWPDV-EAVKGTLDGQQAELQI----YFSQ--GGQAVAIGQ---FKDRITGSNDP----- 158
            |.:||.:..: :.:.||.:...|:|.:    ||.:  ..|.:..||   |...:.|...|     
  Fly   225 PIDEGNYKCIAQNLVGTRESSYAKLIVQVKPYFMKEPKDQVMLYGQTATFHCSVGGDPPPKVLWK 289

Human   159 ---GN------------ASITISHMQPADSGIYICDVNN---------------PPDFLGQNQGI 193
               ||            .|:.||::.|.|.|.|:|:.:|               ||:|       
  Fly   290 KEEGNIPVSRARILHDEKSLEISNITPTDEGTYVCEAHNNVGQISARASLIVHAPPNF------- 347

Human   194 LNVSVLVKPSKPLCSVQGRPETGHTISLSCLSALGTPSPVYYWHK-----------LEGRDIVPV 247
                 ..:||.....:.|      .:.|.|: |.|.|.|..:|.|           ..||..|  
  Fly   348 -----TKRPSNKKVGLNG------VVQLPCM-ASGNPPPSVFWTKEGVSTLMFPNSSHGRQHV-- 398

Human   248 KENFNPTTGILVIGNLTNFEQGYYQCTAINRLGNSSCEIDLTSS----HPEVGIIVGALIGSLVG 308
                 ...|.|.|.::...::|||.|:|.:.:.:|:..:.|..|    .|...|.:|....:|..
  Fly   399 -----AADGTLQITDVRQEDEGYYVCSAFSVVDSSTVRVFLQVSSLDERPPPIIQIGPANQTLPK 458

Human   309 AAIIISVVCFARNKAKAKAK-----------------ERNSKTIAELE-------PMTKINPRGE 349
            .: :.::.|.|......:.|                 :.:|..:.:|:       ..|....|||
  Fly   459 GS-VATLPCRATGNPSPRIKWFHDGHAVQAGNRYSIIQGSSLRVDDLQLSDSGTYTCTASGERGE 522

Human   350 SEAMPREDATQLEVTLP--SSIHETG-PDTIQEPDYEPK 385
            :..     |..|.|..|  :|:|... |.|...|...||
  Fly   523 TSW-----AATLTVEKPGSTSLHRAADPSTYPAPPGTPK 556

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VSIG1XP_005262184.1 Ig 97..189 CDD:299845 29/124 (23%)
IG_like 127..198 CDD:214653 24/114 (21%)
IG_like 216..289 CDD:214653 20/83 (24%)
Ig 219..286 CDD:143165 20/77 (26%)
robo1NP_476899.1 Ig 56..151 CDD:299845
I-set 56..150 CDD:254352
I-set 157..251 CDD:254352 7/25 (28%)
Ig2_Robo 159..251 CDD:143201 7/25 (28%)
I-set 255..341 CDD:254352 19/85 (22%)
Ig3_Robo 272..341 CDD:143202 14/68 (21%)
IG_like 351..436 CDD:214653 24/98 (24%)
Ig 362..444 CDD:299845 22/89 (25%)
I-set 445..531 CDD:254352 14/91 (15%)
IGc2 459..521 CDD:197706 6/62 (10%)
FN3 549..637 CDD:238020 3/8 (38%)
FN3 673..762 CDD:238020
fn3 770..855 CDD:278470
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.