DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VSIG1 and robo3

DIOPT Version :9

Sequence 1:XP_005262184.1 Gene:VSIG1 / 340547 HGNCID:28675 Length:449 Species:Homo sapiens
Sequence 2:NP_608592.2 Gene:robo3 / 33314 FlyBaseID:FBgn0041097 Length:1342 Species:Drosophila melanogaster


Alignment Length:328 Identity:73/328 - (22%)
Similarity:111/328 - (33%) Gaps:74/328 - (22%)


- Green bases have known domain annotations that are detailed below.


Human   137 SQGGQAVAIGQFKDRITGSNDPGNASIT-----------ISHMQPADSGIYICDVNNPPDFLGQN 190
            ::|.....|..:||.:.....||:..||           ::..:..|:|||.|:..|........
  Fly    46 AEGSPTPTIQWYKDGVPLKILPGSHRITLPAGGLFFLKVVNSRRETDAGIYWCEAKNELGVARSR 110

Human   191 QGILNVSVL-----VKPSKPLCSVQGRPETGHTISLSCLSALGTPSPVYYWHK------LEGRDI 244
            ...|.|:||     ::|...      |...|.|..|.|.:..|.|.|...|.|      |||...
  Fly   111 NATLQVA
VLRDEFRLEPQNT------RIAQGDTALLECAAPRGIPEPTVTWKKGGQKLDLEGSKR 169

Human   245 VPVKENFNPTTGILVIGNLTNFEQGYYQCTAINRLGNSSCEIDLTSSHPEVGIIVGALIGS-LVG 308
            |.:.:.     |.|.|.:....::|.|||.|.|.:|.....:.....|.:..||.|....: |.|
  Fly   170 VRIVDG-----GNLAIQDARQTDEGQYQCIAKNPVGVRESSLATLKVHVKPYIIRGPHDQTVLEG 229

Human   309 AAIIISV---------VCFARNKAKAKAKERNSKTIAELEP----MTKINPRGESEAMPREDATQ 360
            |::....         |.:.|.   |.........::.||.    :.::....|.|.....|   
  Fly   230 ASVTFPCRVGGDPMPDVLWLRT---ASGGNMPLDRVSVLEDRSLRLERVTIADEGEYSCEAD--- 288

Human   361 LEVTLPSSIHETGPDTIQEPDYEPKPTQEPAPEPAPGSEPMAVPDLDIELELEPETQSELEPEPE 425
               .:..:|...|..|:..|   ||..|.||.:               .:||..:|..|......
  Fly   289 ---NVVGAITAMGTLTVYAP---PKFIQRPASK---------------SVELGADTSFECRAIGN 332

Human   426 PEP 428
            |:|
  Fly   333 PKP 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VSIG1XP_005262184.1 Ig 97..189 CDD:299845 14/62 (23%)
IG_like 127..198 CDD:214653 16/71 (23%)
IG_like 216..289 CDD:214653 23/78 (29%)
Ig 219..286 CDD:143165 21/72 (29%)
robo3NP_608592.2 Ig 22..117 CDD:299845 15/70 (21%)
I-set 23..116 CDD:254352 15/69 (22%)
I-set 122..211 CDD:254352 25/99 (25%)
Ig 125..211 CDD:299845 25/96 (26%)
I-set 215..302 CDD:254352 16/95 (17%)
Ig 232..302 CDD:299845 10/78 (13%)
I-set 306..401 CDD:254352 11/45 (24%)
Ig 320..411 CDD:299845 4/16 (25%)
I-set 412..492 CDD:254352
IGc2 429..489 CDD:197706
FN3 519..612 CDD:238020
FN3 644..735 CDD:238020
fn3 743..832 CDD:278470
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.