DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VSIG1 and DIP-beta

DIOPT Version :9

Sequence 1:XP_005262184.1 Gene:VSIG1 / 340547 HGNCID:28675 Length:449 Species:Homo sapiens
Sequence 2:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster


Alignment Length:489 Identity:94/489 - (19%)
Similarity:155/489 - (31%) Gaps:188/489 - (38%)


- Green bases have known domain annotations that are detailed below.


Human     6 WKVFLIL---SCL----AGQVSVVQVTIPDGFV----NVTV--GSNVTLICIYTTTVASREQLSI 57
            |::.|:|   :|:    :.::|.|....|| ||    |||:  |.:.|..|:.......|     
  Fly    70 WQLLLLLLLGNCIDLTVSNKISSVGAFEPD-FVIPLENVTIAQGRDATFTCVVNNLGGHR----- 128

Human    58 QWSFFHKKEMEPISHSSCLSTEGMEEKAVSQCLKMTHARDARGRCSWTSESPWEEGKWPDVEAVK 122
                              :|.:|               ..|..:.:|..         .|.:|: 
  Fly   129 ------------------VSGDG---------------SSAPAKVAWIK---------ADAKAI- 150

Human   123 GTLDGQQAELQIYFSQGGQAVAIGQF----KDRIT-GSNDPGNASITISHMQPADSGIYICDVNN 182
                                :||.:.    .||:: ..||....::.|..::..|:|.|:|.||.
  Fly   151 --------------------LAIHEHVITNNDRLSVQHNDYNTWTLNIRGVKMEDAGKYMCQVNT 195

Human   183 --------------PPDFLG-QNQGILNVSVLVKPSKPLCSVQGRPETGHTISLSCLSALGTPSP 232
                          |||.:. :..|.:.|                || |.:..|.| .|.|.|.|
  Fly   196 DPMKMQTATLEVVIPPDIINEETSGDMMV----------------PE-GGSAKLVC-RARGHPKP 242

Human   233 VYYWHKLEGRDIVPVKENFNPTTG------ILVIGNLTNFEQGYYQCTAINRLGNS-SCEIDL-T 289
            ...|.:.:||:|:....:...|..      :|.:..:|..|.|.|.|.|.|.:..: |..:.| .
  Fly   243 KITWRREDGREIIARNGSHQKTKAQSVEGEMLTLSKITRSEMGAYMCIASNGVPPTVSKRMKLQV 307

Human   290 SSHPEVGIIVGALIGSLVGAAIIISVVCFARNKAKAKA----------------------KERNS 332
            ..||.|.:     ...||||.::..|......:|..||                      ||.|.
  Fly   308 HFHPLVQV-----PNQLVGAPVLTDVTLICNVEASPKAINYWQRENGEMIIAGDRYALTEKENNM 367

Human   333 KTIAELEPMTKI-------------NPRGESEAMPR-----------------EDATQLEVTLPS 367
            ..|..:..:.::             |..|::|...|                 .:.::.||....
  Fly   368 YAIEMILHIKRLQSSDFGGYKCISKNSIGDTEGTIRLYEMERPGKKILRDDDLNEVSKNEVVQKD 432

Human   368 SIHETGPDTIQEPDYEPKPTQEPAPEPAPGSEPM 401
            :..|.|...:....|:.:   .|...||.||:.:
  Fly   433 TRSEDGSRNLNGRLYKDR---APDQHPASGSDQL 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VSIG1XP_005262184.1 Ig 97..189 CDD:299845 20/111 (18%)
IG_like 127..198 CDD:214653 18/90 (20%)
IG_like 216..289 CDD:214653 22/80 (28%)
Ig 219..286 CDD:143165 20/73 (27%)
DIP-betaNP_001138225.1 I-set 98..209 CDD:254352 30/179 (17%)
ig 102..195 CDD:278476 25/160 (16%)
IG_like 219..307 CDD:214653 26/105 (25%)
Ig 221..307 CDD:299845 25/103 (24%)
Ig 311..404 CDD:299845 17/97 (18%)
IG_like 327..405 CDD:214653 12/77 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.