DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATPsynGL and AT2G19680

DIOPT Version :10

Sequence 1:NP_609142.1 Gene:ATPsynGL / 34054 FlyBaseID:FBgn0031941 Length:107 Species:Drosophila melanogaster
Sequence 2:NP_179558.1 Gene:AT2G19680 / 816487 AraportID:AT2G19680 Length:122 Species:Arabidopsis thaliana


Alignment Length:75 Identity:20/75 - (26%)
Similarity:35/75 - (46%) Gaps:16/75 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 PADFQKLKQTAES---AKLAS--------KKDM---KGQLKKSGLSQVTVAEAWLNVLVTVEVIT 89
            ||..:|..:.::.   .:|||        :|::   |..||..  :.:.|.:|.:..|..:|...
plant    41 PATIEKCSELSKQLLYTRLASIPGRYETFRKEVDYAKNLLKNR--ANLKVEDAGIAALFGLECFA 103

  Fly    90 WFYMGEVIGR 99
            ||..||::||
plant   104 WFCAGEIVGR 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATPsynGLNP_609142.1 ATP-synt_G 6..105 CDD:461408 20/75 (27%)
AT2G19680NP_179558.1 ATP-synt_G 14..120 CDD:461408 20/75 (27%)

Return to query results.
Submit another query.