DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATPsynGL and ATPsynG

DIOPT Version :9

Sequence 1:NP_609142.1 Gene:ATPsynGL / 34054 FlyBaseID:FBgn0031941 Length:107 Species:Drosophila melanogaster
Sequence 2:NP_001036353.1 Gene:ATPsynG / 46069 FlyBaseID:FBgn0010612 Length:99 Species:Drosophila melanogaster


Alignment Length:107 Identity:55/107 - (51%)
Similarity:68/107 - (63%) Gaps:8/107 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSQLIAKAKTLVNKMIVAARPQLDEFWKYAKVELSPPLPADFQKLKQTAESAKLASKKDMKGQLK 65
            |:.|..|...|||:::..||||||.|.|||||||:||.|||...::|...:.       :|| .|
  Fly     1 MASLATKGSGLVNRLLTQARPQLDVFLKYAKVELTPPTPADIPAIRQGLGNI-------IKG-AK 57

  Fly    66 KSGLSQVTVAEAWLNVLVTVEVITWFYMGEVIGRRHLVGYKV 107
            ......:||.|||||.|||.|||.|||:||.||:||:|||.|
  Fly    58 TGAYKNLTVREAWLNTLVTAEVIFWFYIGECIGKRHIVGYNV 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATPsynGLNP_609142.1 ATP-synt_G 12..106 CDD:282561 49/93 (53%)
ATPsynGNP_001036353.1 ATP-synt_G 6..97 CDD:398409 50/98 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472741
Domainoid 1 1.000 86 1.000 Domainoid score I8063
eggNOG 1 0.900 - - E1_KOG4103
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I5107
Isobase 1 0.950 - 0 Normalized mean entropy S3876
OMA 1 1.010 - - QHG52212
OrthoDB 1 1.010 - - D1461139at2759
OrthoFinder 1 1.000 - - FOG0003653
OrthoInspector 1 1.000 - - otm26629
orthoMCL 1 0.900 - - OOG6_104623
Panther 1 1.100 - - P PTHR12386
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2416
SonicParanoid 1 1.000 - - X3021
1413.790

Return to query results.
Submit another query.